KEGG   Thermanaerovibrio acidaminovorans: Taci_0198Help
Entry
Taci_0198         CDS       T01129                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Taci_0198
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Taci_0198
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Taci_0198
Enzymes [BR:tai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Taci_0198
Exosome [BR:tai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Taci_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216643..218268
Genome map
AA seq 541 aa AA seqDB search
MVRRIRCWVMLLALLLVTAPADARARNVIVLMCDGTGATHTTVARWYKGGPLAMDQMYVG
RVRTWGAESLITDSAPAATAFATGHKASDKAIGVMPWSVAMPGVPAVTEETKARPVASVL
EAAKLAGKATGIVVTSNVQHASPAAYSSHWPDRNDYNEIGEQQLYLGMDVIFGGGSRYLI
PAEKGGARKDGEDLMEEARRLGYRVVSDRSGMMSLSSGRVLGLFAPDDLSYEFDRPVLTP
SQPSLSEMTAKAIEILSKDPDGFFLFVEGSKIDWASHANDPVGVVSDVLAFDDAVLVALD
FARRSGDTAVLVFSDHGNGGMSLGSKVTDASYSKLPLNALVEPLRRARLTGEGVERLLGD
QRTESGIREVVASNYGITDLTDDEVKAIAQAEKGRMNYVLGPILSRRSPIGWTTNGHTGE
DLFINYYGLKEPLKTIENTDIARICAREMGVNLDEATSRLFVDAFAVFGSMGASVRLDKS
DPNNQVLVVERGRVRAEIPLSKSTMRLGGRVVSTGGLSVLSPITGKVYVPQRAVEVFKAA
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaaggatccgatgttgggtgatgctgttggccctgttgctggtgaccgccccg
gcggacgccagggccaggaacgtcatagtcctgatgtgtgatggcaccggtgccacccac
accaccgtggcccgttggtacaaggggggtcccctggccatggatcagatgtacgtgggg
cgggtgcgcacctggggggcggagagcctcataaccgactcggccccggcggccaccgcc
tttgccaccggccacaaggccagcgacaaggccataggggtaatgccctggtcggtagcc
atgcccggcgtgccggcggtcacggaggagaccaaggcccgtccggtggccagcgtccta
gaggccgccaagctggccggcaaggccaccggtatagtggtcacctccaacgtgcagcac
gccagccctgccgcttattcgtctcactggcccgatcgaaacgattacaacgagataggg
gagcagcagctgtatttggggatggacgtgatcttcggcgggggcagccgataccttatc
cctgcggaaaaggggggtgcccggaaggatggggaggatcttatggaggaggcccggcga
cttggctaccgggtggtgtccgatcgctccggcatgatgtcgctgagctccggcagggtt
ttgggcctctttgccccggacgacctgtcatacgagtttgaccgtccggtgctcacccca
tcccagccctcgctgtcggagatgaccgccaaggccatagagatcctatccaaggatccg
gacggcttcttcctcttcgtggagggatccaagatagactgggcctcccacgccaacgac
ccggtgggggtggtgtccgacgtgctggccttcgacgacgcggtcctggtggccctggac
ttcgccaggaggagcggggacacggcggtgctggtcttctccgaccacgggaacggaggc
atgtcgctgggcagcaaggtcaccgacgccagctactccaagctgccgctgaacgccctg
gtggagcccttgaggcgggccaggctgaccggtgagggggttgagcggttgctgggagac
cagaggaccgagtcgggtatccgggaggtggtggcctccaactacgggatcacggatctg
acggatgacgaggtgaaggccatagcccaggccgagaagggccggatgaactacgtcctg
ggccccatcctatccaggcggagccccatcgggtggaccaccaatggccacaccggagag
gacctcttcataaactactatggtctcaaggagccgctcaagaccatagagaacaccgac
atagccaggatctgtgcccgggagatgggggtgaacttggatgaggccacctctaggctc
ttcgtggacgcctttgccgtcttcggctccatgggtgcctcggtcaggttggataaatcg
gatcccaacaatcaggtcctggtggtggagaggggcagggtcagggctgagatcccgctg
agcaagagcacgatgcgccttggcggcagggttgttagcaccggtgggttgtcggtcctg
tcccccataacgggcaaggtctacgtgccccagcgggcggtggaggtcttcaaggccgca
atgtag

DBGET integrated database retrieval system