KEGG   Thermanaerovibrio acidaminovorans: Taci_0217Help
Entry
Taci_0217         CDS       T01129                                 

Definition
(RefSeq) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00030  Pentose phosphate pathway
tai01100  Metabolic pathways
tai01120  Microbial metabolism in diverse environments
tai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Taci_0217
Enzymes [BR:tai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Taci_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-GeneID: 8630027
NCBI-ProteinID: YP_003316738
UniProt: D1B853
Position
236739..238586
Genome map
AA seq 615 aa AA seqDB search
MILTRFHVDLSSRRVEREDVDPVEVRRWGGGKGLALPVLLDRIGPSVDPLGPQNVLILAA
GLLTGMPFHGMCRYGAYARSPLTMGYGESEAGGFFGPGIRSQGVDSLVLTGRADETCYLW
VQDRQVSVIPDPAMAGMETGEVMDRLRDRHGDCTAVVVGPAAEALVRFACIVNDLHHVNG
RSGLGAVMASKNVKAVACPSPRALPVQDRQLLSELQRLFAGWRDHPGAMGLHRYGTSATL
MGLNSMGMLPTRNFREGIFEGAQAIGHEALTDRYLIDRGGCFACAVRCKRVAGGGRYGAD
SRYGGPEYETLASFGSLCGVDDLEAILKAHELCNRLGLDTISCGMSIAWLMECVEEGLVD
PGDAVVSGFGDPEGMLRLIPMIASRTGVGDLLAEGTHRAAKRLGKGSSRFCLTIKGQEMA
MHDPRGKVGVALGYGVAASGADHLQVPYDTLFTNPESFACEAVKPLGILESMDLTGFAPS
KVAAMGELWKIWGAINHLGGCYFVFAPRSYFPLERIPDLVSAMTGWRTSLIEISKMGHRG
HCAARILNRRLGQGAEDDSLPLRMHQPLPHGPFEGRPIDPGEYRRALEMFYHLMGWDREG
NPTEHTRLALGLPLD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgacccgttttcacgtggacctgtcctcccgccgggtggagcgggaggatgtg
gacccggtggaggtgcgtcgatggggtggcggcaaggggctggcgctaccggtcctactg
gaccggatcggcccatcggtggaccccttgggtccccagaacgtgctcatcctggcggcg
gggcttctgaccggcatgccctttcacggcatgtgccgctacggggcctacgccaggagc
cccctcaccatgggctacggggagagcgaggcggggggcttcttcggccccggcatccga
tcccagggggtggactccctggtcctcaccggcagggcggatgagacctgctacctgtgg
gtccaggaccgccaggtgtccgtgatccccgatccggccatggcggggatggagaccggg
gaggtgatggaccgcctccgggatcgccacggggactgcaccgccgtggtggtgggcccc
gcggcggaggccctggtgcggttcgcctgcatcgtcaacgacctgcaccacgttaacggc
cgctccgggctgggggcggtgatggcctccaagaacgtgaaggcggtggcgtgcccctcc
cccagggcgctcccggtgcaggaccggcagctcctgtcggagctacagcggctcttcgcc
ggctggcgggatcacccgggggccatggggctccaccggtacggcacctccgccacgctg
atggggctcaactccatggggatgctccccacccgcaacttccgggaggggatcttcgag
ggggcccaggccataggccacgaggcgctgacggaccggtacctgatcgaccggggcggg
tgcttcgcctgcgcggtccggtgcaagcgggttgcggggggaggccggtacggggcggac
agccgctacggggggcccgagtacgagactttggcatccttcgggtccctctgcggggtg
gacgacctggaggcgatcctcaaggcccacgagctctgcaaccggctggggctggacacc
atatcctgcggcatgtccatcgcctggctcatggagtgcgtggaggaggggcttgtggac
ccgggggacgcggtggtgtccggcttcggcgacccggaggggatgctcaggctgatcccc
atgattgcctcccggaccggggtaggggacctgctggcggaggggacccatcgggccgcc
aagaggctgggcaagggtagctcccggttctgcctcaccataaagggccaggagatggcc
atgcacgacccaagggggaaggtgggggtggccctggggtacggggtggccgcctccggg
gcggaccacctgcaggtgccctacgacaccctcttcaccaacccggagtccttcgcctgt
gaggcggtgaagcccctgggcatcctggagagcatggacctcaccggcttcgccccgtcg
aaggtggccgccatgggggagctgtggaagatatggggggccataaaccacctggggggg
tgctacttcgtcttcgcccccaggagctacttccccctggagcggataccggacctggtg
agcgccatgaccggctggaggacgtcgctgatagagatatccaagatggggcaccgggga
cactgcgccgcccggatcctgaaccgccggctgggtcagggggcggaggacgacagcctg
ccccttaggatgcaccagccccttccccacgggcccttcgaggggcgccccatagacccg
ggggagtaccggcgggctctggagatgttctaccacctgatgggatgggaccgggagggg
aaccccacagagcacacccggctggcgcttgggcttcctttggattaa

DBGET integrated database retrieval system