KEGG   Thermanaerovibrio acidaminovorans: Taci_0217Help
Entry
Taci_0217         CDS       T01129                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Taci_0217
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Taci_0217
Enzymes [BR:tai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Taci_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236739..238586
Genome map
AA seq 615 aa AA seqDB search
MILTRFHVDLSSRRVEREDVDPVEVRRWGGGKGLALPVLLDRIGPSVDPLGPQNVLILAA
GLLTGMPFHGMCRYGAYARSPLTMGYGESEAGGFFGPGIRSQGVDSLVLTGRADETCYLW
VQDRQVSVIPDPAMAGMETGEVMDRLRDRHGDCTAVVVGPAAEALVRFACIVNDLHHVNG
RSGLGAVMASKNVKAVACPSPRALPVQDRQLLSELQRLFAGWRDHPGAMGLHRYGTSATL
MGLNSMGMLPTRNFREGIFEGAQAIGHEALTDRYLIDRGGCFACAVRCKRVAGGGRYGAD
SRYGGPEYETLASFGSLCGVDDLEAILKAHELCNRLGLDTISCGMSIAWLMECVEEGLVD
PGDAVVSGFGDPEGMLRLIPMIASRTGVGDLLAEGTHRAAKRLGKGSSRFCLTIKGQEMA
MHDPRGKVGVALGYGVAASGADHLQVPYDTLFTNPESFACEAVKPLGILESMDLTGFAPS
KVAAMGELWKIWGAINHLGGCYFVFAPRSYFPLERIPDLVSAMTGWRTSLIEISKMGHRG
HCAARILNRRLGQGAEDDSLPLRMHQPLPHGPFEGRPIDPGEYRRALEMFYHLMGWDREG
NPTEHTRLALGLPLD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgacccgttttcacgtggacctgtcctcccgccgggtggagcgggaggatgtg
gacccggtggaggtgcgtcgatggggtggcggcaaggggctggcgctaccggtcctactg
gaccggatcggcccatcggtggaccccttgggtccccagaacgtgctcatcctggcggcg
gggcttctgaccggcatgccctttcacggcatgtgccgctacggggcctacgccaggagc
cccctcaccatgggctacggggagagcgaggcggggggcttcttcggccccggcatccga
tcccagggggtggactccctggtcctcaccggcagggcggatgagacctgctacctgtgg
gtccaggaccgccaggtgtccgtgatccccgatccggccatggcggggatggagaccggg
gaggtgatggaccgcctccgggatcgccacggggactgcaccgccgtggtggtgggcccc
gcggcggaggccctggtgcggttcgcctgcatcgtcaacgacctgcaccacgttaacggc
cgctccgggctgggggcggtgatggcctccaagaacgtgaaggcggtggcgtgcccctcc
cccagggcgctcccggtgcaggaccggcagctcctgtcggagctacagcggctcttcgcc
ggctggcgggatcacccgggggccatggggctccaccggtacggcacctccgccacgctg
atggggctcaactccatggggatgctccccacccgcaacttccgggaggggatcttcgag
ggggcccaggccataggccacgaggcgctgacggaccggtacctgatcgaccggggcggg
tgcttcgcctgcgcggtccggtgcaagcgggttgcggggggaggccggtacggggcggac
agccgctacggggggcccgagtacgagactttggcatccttcgggtccctctgcggggtg
gacgacctggaggcgatcctcaaggcccacgagctctgcaaccggctggggctggacacc
atatcctgcggcatgtccatcgcctggctcatggagtgcgtggaggaggggcttgtggac
ccgggggacgcggtggtgtccggcttcggcgacccggaggggatgctcaggctgatcccc
atgattgcctcccggaccggggtaggggacctgctggcggaggggacccatcgggccgcc
aagaggctgggcaagggtagctcccggttctgcctcaccataaagggccaggagatggcc
atgcacgacccaagggggaaggtgggggtggccctggggtacggggtggccgcctccggg
gcggaccacctgcaggtgccctacgacaccctcttcaccaacccggagtccttcgcctgt
gaggcggtgaagcccctgggcatcctggagagcatggacctcaccggcttcgccccgtcg
aaggtggccgccatgggggagctgtggaagatatggggggccataaaccacctggggggg
tgctacttcgtcttcgcccccaggagctacttccccctggagcggataccggacctggtg
agcgccatgaccggctggaggacgtcgctgatagagatatccaagatggggcaccgggga
cactgcgccgcccggatcctgaaccgccggctgggtcagggggcggaggacgacagcctg
ccccttaggatgcaccagccccttccccacgggcccttcgaggggcgccccatagacccg
ggggagtaccggcgggctctggagatgttctaccacctgatgggatgggaccgggagggg
aaccccacagagcacacccggctggcgcttgggcttcctttggattaa

DBGET integrated database retrieval system