KEGG   Thermanaerovibrio acidaminovorans: Taci_0334Help
Entry
Taci_0334         CDS       T01129                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tai  Thermanaerovibrio acidaminovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358524..359195
Genome map
AA seq 223 aa AA seqDB search
MIVWRDFARRMVEVVRMNGVRDGEVLRVLGEVPRHLFIPSLRGPCEAGDQGALRTAYGDH
PLPIGFGQTISQPTMVGRMTELLSPEPPVRVLEVGSGCGYQCAVLARMGCSVVGVERIRD
LADWSREVLGGLGMEVSIIHGDGRALGGDLGPFDGIVVSAGCSREDAEGIFGAFGGDGCR
MVAPVNVGGGLQRVLVLEMEGGEVRESWQDLCRFVPLLGGVEG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtgtggcgggacttcgcccgcaggatggtggaggtggtccggatgaacggggtg
agggacggggaggtgctaagggtcctgggtgaggtgccgaggcacctgttcataccctcc
ctgagggggccctgtgaggcgggggatcaaggggcgttgaggaccgcctatggggatcac
ccgttgcccataggcttcggtcagaccatatcccagcccaccatggtgggtcggatgacg
gagcttctctcccccgagcccccggttagggtgttggaggtggggagcggttgcggctat
cagtgcgccgtgttggcccggatgggctgttccgtggtgggggtggagaggatccgggat
ctggcggactggtcaagggaggtgctgggtgggttgggcatggaggtatccataatccac
ggggacggcagggccctcgggggggatctggggccctttgacggcatagtggtgtccgcc
ggttgttccagggaggatgcggagggcatatttggggccttcggtggggatgggtgccgg
atggtggccccggttaacgtgggagggggtcttcaacgggtgttagtgctggagatggag
gggggtgaggtcagggagagctggcaggacctgtgccggttcgtgcccctgctgggcggg
gtggaggggtga

DBGET integrated database retrieval system