KEGG   Thermanaerovibrio acidaminovorans: Taci_0363Help
Entry
Taci_0363         CDS       T01129                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Taci_0363
Enzymes [BR:tai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Taci_0363
Exosome [BR:tai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Taci_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387426..389339
Genome map
AA seq 637 aa AA seqDB search
MSRAVPGISLMSDYDVYLFKEGRHFRLYRCLGCHPMEVDGQPGALFALWAPNAEWVSVAG
DFNGWDPDSHRLYPRWDGSGIFEGFVPFAKAGDVYKYVIRSRVTGETYEKTDPFGFLFEC
PPRSGSVVWDLSYSWGDGEWMEGRGAKNWLESPWTIYEAHLGSWQRVPEEGNRPLYYREA
AERLGNYLRETGFTHLELLPVMEHPFYGSWGYQTLGYFAPTSRYGSPQDFMCLVDHLHRL
GIGVILDWVPSHFPKDGHGLGFFDGTCLFEHQDPRKGYHPDWKSGIFNYDRPEVVSFLGS
SAAFWCDVYHADALRVDAVASMLYLDYSRPPGEWVPNRYGGRENLGAIEFLRAMNAELYR
SFPGVETIAEESTSWPMVSRPAFLGGLGFGMKWNMGWMHDVLRHMSRDPIHRRWHLEELT
FGLWYNYSENFVLPLSHDEVVHGKGSLWGKMWGDPWQRAAALRLLYGWMYCHPGKKLLFM
GGEFGQEAEWDHDRSLDWHLIAQSDLHRGVFQWVKDLNRFLRERPCLYQLDFQREGFQWV
DCDDRDNVVLSCIRFSRDGGMVLGIGNFTPVTRRGYVVGVPRGGFWREALNSDGACYGGS
GEGNLGGVWARDQGSHGRPFSLELTLPGHSFIFLEPA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgcgcagtaccggggatcagcctcatgagcgactacgacgtttaccttttcaag
gaggggcggcacttccgactctaccggtgtctcggttgtcaccccatggaggtggacggc
cagcccggggccctcttcgccctttgggcccccaacgcggaatgggtgtcggtggcgggg
gacttcaacggatgggacccggactcccaccggctctacccccggtgggacgggtccggg
atcttcgagggtttcgtccccttcgccaaggcgggggacgtctacaagtacgtgataagg
tcccgggtgaccggcgagacctacgagaagacggatcccttcggcttcctcttcgagtgt
cctcccaggagcggttcggtggtgtgggacctgtcgtactcctggggggatggggaatgg
atggaggggcggggggccaagaactggctggagtccccctggaccatatatgaggcccac
ctgggttcctggcagagggtgccagaggaggggaaccgtccgctgtactaccgggaggcg
gcggagaggcttggcaactacctgagggagacgggcttcacccacctggagctgttgccg
gtgatggagcatccattctacggatcctggggctaccagaccctgggctacttcgccccc
acctcccgctacggctccccccaggacttcatgtgcctggtggaccacctacaccggctg
gggataggggtcatcctggattgggttccctcccactttcccaaggacggccacgggctg
ggcttcttcgacggcacctgccttttcgagcaccaggacccccgaaagggttaccacccg
gactggaagtccgggatcttcaactacgaccggcccgaggtggtcagcttcctggggagc
tccgccgccttctggtgcgacgtgtaccacgcggacgccctgcgggtggacgcggtggct
tccatgctctacctggactactcccggcccccgggggagtgggtccccaaccggtacgga
gggagggagaacctgggggccatcgagttcctccgggccatgaacgcggagctataccgg
agcttcccgggggtggagaccatagcggaggagtccacctcctggcccatggtgagccga
cccgcgttcctgggggggctaggcttcggcatgaagtggaacatgggctggatgcacgac
gtgttgcgccacatgtcccgggatccgatccaccggaggtggcacctggaggagctcacc
ttcggcctctggtacaactactcggagaacttcgtcctacccctctcccatgacgaggtg
gtccacggaaagggctccctgtgggggaagatgtggggggatccgtggcagagggcggcg
gcgctaaggctcctctacggctggatgtactgccatccgggcaagaagttgctcttcatg
gggggcgaattcggccaggaggcggagtgggatcacgataggagcctggactggcacctg
atagcccagtcggacctgcaccggggggtcttccagtgggtcaaggacctgaaccgtttc
ctccgggagcggccgtgcctctaccagctggacttccagagggaggggttccagtgggtt
gactgcgacgaccgggacaacgtggtcctgtcgtgcatcagattctcccgggacggggga
atggtgctgggcataggcaacttcaccccggttacccgccggggttacgtggtgggggtc
cccaggggaggcttctggcgggaggccctcaactccgacggggcctgctacgggggctcc
ggggagggcaacctgggtggggtgtgggcccgggaccagggatcccacggcaggcccttc
tccctggagctgaccctgccgggccactcgttcatcttcctggagcccgcttga

DBGET integrated database retrieval system