KEGG   Thermanaerovibrio acidaminovorans: Taci_0364Help
Entry
Taci_0364         CDS       T01129                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Taci_0364
Enzymes [BR:tai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Taci_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389354..390838
Genome map
AA seq 494 aa AA seqDB search
MFLERRRGVLLHFTSLPGPYGAGDLGPVARSVAEGMAAQGWTIWQMLPLNYPNPAMGFSP
YASYGALPLNPTVISLDDLAEEGWIPGEELRNLQVRLPDPWRADLQGAFRARRAGVALAF
QALKRGHMRDRYLEFRQREWEWLEGWGVFMALKDSLGGSHWVHWPERFRSLERALAHWDE
GLEEGAELYRFEQFLARRQLDRFRAHCEALGVRLLGDMPIYVAHDGMDPWACPYLFELDG
EGNPVEVAGVPPDYFSETGQRWGNPLYRWEAMGEDRYLWWRVRLRKALEWFHAVRLDHFR
GFAGYWAIPAEEMTAVRGRWRPGPGEALFDALVEDLGGDPSGEGPSLPIVAEDLGVITQD
VTRLRLRYRLPGMRVLQFAFSGGDDNPHLPFNHEGLGLAYTGTHDNDTTLGWWLSASAEE
RRGLFRYVGRPLTAEEAVREMVRLALNSPSRWRIVPLQDLMLLGSRHRMNTPSSREGNWV
FRAMRVELDGLLGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggagcgcaggaggggagtgctgcttcacttcacgtccctgccaggtccctac
ggggcaggggacctggggcccgtggccaggtccgtggcggaggggatggccgctcagggg
tggaccatctggcagatgctgcccctcaactaccctaaccccgccatgggcttcagcccc
tacgcctcctacggggccctgcccctgaaccccacggtgatatccctggatgacctggcg
gaggagggctggatacccggggaggagctccgcaacctccaagtacggctgccggatccc
tggagggcggacttgcagggggccttccgggcccgaagggcgggggttgccctggccttc
caggccctcaagagggggcacatgagggaccggtacctggagtttcgccagcgggagtgg
gagtggcttgagggctggggggtcttcatggccctgaaggactccctggggggcagccac
tgggtccactggcccgagcgcttcaggtcccttgagagggccctggcccactgggacgaa
gggctggaggagggggcggagctgtaccggttcgagcagttcctggccaggcgacagctg
gaccggttcagggcccactgcgaggccctgggggtgaggctcctgggggacatgcccatc
tacgtggcccacgacggcatggacccctgggcctgcccgtacctgttcgagctggacggg
gaggggaacccggtagaggtggctggggtgccgccggactacttcagcgagaccggccag
cggtggggcaaccccctgtaccggtgggaggccatgggggaggaccggtacctatggtgg
cgggtgaggctccgcaaggccctggagtggttccacgcggtccggctggatcacttccgg
ggttttgcggggtactgggccataccggcggaggagatgaccgcggtgaggggccgttgg
aggccggggccaggggaggcccttttcgatgccctggtggaggacctggggggagatcca
tccggggagggaccctccctgcccatcgtggcggaggacctgggggtgataacccaggac
gttacccgcctcaggctaaggtaccggctaccggggatgcgggtcctccagttcgctttc
tccgggggtgatgacaatccccacctgcctttcaaccacgaggggctgggattggcgtac
accggcacccacgacaacgacaccaccctgggctggtggctatccgcctcggcggaggag
aggagggggctcttccggtacgtggggaggcccctcacggcggaggaggcggtgagggag
atggtgcgcctggcgctgaactcccccagccggtggaggatcgtgcccctgcaggacctg
atgctattggggtccagacaccggatgaacaccccctcgtcccgggagggcaactgggtc
ttccgggccatgagggtggagcttgacgggctccttgggggttga

DBGET integrated database retrieval system