KEGG   Thermanaerovibrio acidaminovorans: Taci_0468Help
Entry
Taci_0468         CDS       T01129                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_0468
   00030 Pentose phosphate pathway
    Taci_0468
   00051 Fructose and mannose metabolism
    Taci_0468
   00052 Galactose metabolism
    Taci_0468
   00500 Starch and sucrose metabolism
    Taci_0468
   00520 Amino sugar and nucleotide sugar metabolism
    Taci_0468
  Nucleotide metabolism
   00230 Purine metabolism
    Taci_0468
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Taci_0468
Enzymes [BR:tai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Taci_0468
    5.4.2.8  phosphomannomutase
     Taci_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(497040..498428)
Genome map
AA seq 462 aa AA seqDB search
MPKVPSHIFREYDIRGLAEEELTSHNVRLIAQAYGTFLRSRGVGTATVGGDVRHSTRRIM
DAAIGGLTEAGVNVIDLGTVATPCFYWSLHHFGVDGGIMVTGSHNPKEFNGLKLAFGKVT
LYGDEIQEIRRIIEEDRIQIPGGASVRREDIKEAYISMLASKITLGSRKLKVVVDSGNGT
GGLFAPEMLRRIGCEVIELFSEPDGTFPNHHPDPTKRENLPKLIETVRAHGADAGVGFDG
DSDRIGVVDDQGEVIWGDRLMILYWSEILPKHPGAEVIVEVKSSMALPEEAQRMGGRPLW
WKSGHSLIKAKMKEISALFAGEVSGHMFFADEFYGFDDAFYAAGRLMRILSNTDEKLSQI
MSRIPKYPSTAETRVDCPNDQVKFQVVERVVERALKEKLQTITVDGVRIIYPNGWGLVRA
SNTQPVLVTRCEGRTQEDLDTICKDMKARLLEAGLGEFEWEF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggtaccctctcacatcttcagggagtacgacatcaggggtctggcggaggag
gagctcacatcccataacgtgcgcctcatagcccaggcgtacggcacgttcctaaggtcc
aggggggtagggaccgccaccgtagggggcgacgtgagacactccaccaggaggataatg
gacgccgccatagggggcctcaccgaggcgggggtgaacgtgatagacctgggcaccgtg
gccaccccttgcttctactggagcctgcaccacttcggggttgacgggggcatcatggtc
accggcagccacaaccccaaggagttcaacggacttaagctggccttcggcaaggtgacc
ctctacggggacgagatccaggagatccggcggatcatcgaggaggaccggatccagatc
cccggcggcgcctcggttcgccgggaggacatcaaggaggcctacatatccatgctggcc
tccaagataaccctggggtccaggaagctgaaggtggtggtggactccggcaacggcacc
ggcgggctcttcgcgccggagatgctccgtcggataggctgtgaagtgatcgagctattc
agcgagccggacggcaccttccccaaccaccatccggaccccaccaagagggagaacctg
cccaagctcatcgagaccgtcagggcccacggggccgacgcgggggtgggcttcgacggt
gactcggaccggatcggggttgtggacgaccagggggaggtcatctggggggacaggcta
atgatcctctactggtccgagattctgcccaagcaccccggggcggaggtgatcgtggag
gtcaagagctccatggcgctcccagaggaggcccagcgaatggggggacgccccctctgg
tggaagtccgggcactccctcataaaggcgaagatgaaggagataagcgccctcttcgcc
ggggaggtctcgggacacatgttcttcgccgacgagttctacggtttcgacgacgccttc
tacgcggcaggtcgcctcatgaggatcctctccaacacggacgagaagctgtcccagatc
atgtcccggatacccaagtacccgagcaccgccgagacccgggtggactgccccaacgac
caggtgaagttccaggtggtggagcgggtggtggagcgggccctcaaggagaagcttcag
accatcaccgtggacggggtaaggataatctaccccaacggctggggcctagtcagggcc
tccaacacccagccggtgctggtgacccgctgcgagggcaggacccaggaggacctggac
accatctgcaaggacatgaaagcccggctgctggaggcagggctgggggagttcgagtgg
gagttctga

DBGET integrated database retrieval system