KEGG   Thermanaerovibrio acidaminovorans: Taci_0474Help
Entry
Taci_0474         CDS       T01129                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tai01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tai00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503109..504917
Genome map
AA seq 602 aa AA seqDB search
MKGWIGRVLRVNLSEGTYRSEPLNEEWAREYLGGRGLGTRYYFEEVGPSVDPLSEGNNLY
FATGPLTGTLAASAGRFNVVAKSPLTGTIGAANSGGYLGPEMKFAGWDMIVIEGKAPKPV
YVYVNNDQVRIEDASSLWGTETHEATDRLLEMTDPEAKVAVIGPAGENLSLIANIINDKH
RAPGRGGMGAVMGAKNLKALVVRGTKGVSVADREAFMRAVKVAREKLAQHPVTGSGLPLY
GTNVLVNILNQNGGLPTRNFREGVFEGADKISGEAQREGRLLRNKGCFGCSIGCGRVSFA
EGYDHHGEGPEYETSWSFGADCGVDDIDAVAMANYRCNELGLDTISMGSTIACAMELYEM
GLITKEMAGLELRFGNKDALVPMVEAAAHKRGKIGELLSMGSYRLASHFGHPELSMTSKK
QEMPAYDPRAIQGIGLNYATSNRGACHVRGYTISPEILGVPQKLDPQSTEDKPTWDKVFQ
DLTAAVDSVGMCLFTTFGIGAEEIADQLSAATGIDYSVDALMKAGERIWNMERLFNLKEG
FTSADDSLPPRMTQEPLPHGPHKGKVSRVPEMLPRYYDARGWTSDGVPTEDKIRELGLQW
AR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggctggataggacgggtcctgcgggtgaacctgtcggagggtacctatcggtcg
gagcccctgaacgaggagtgggccagggagtacctggggggccgcggtctcggcacccgg
tactacttcgaggaggtgggcccctcggtggatcccctgtcggaggggaacaacctctac
ttcgccaccggtcccctgacgggcaccctggcggcctccgccgggaggttcaacgtggtg
gccaagagccccctgacgggcaccataggggccgccaactccggcggctacctggggccg
gagatgaagttcgccggctgggacatgatcgtaatagagggcaaggcccccaagccggtc
tacgtctacgtcaacaacgaccaggttcggatcgaggacgcctcctccctgtggggaacc
gagacccacgaggccaccgacaggctcctggagatgaccgatccggaggccaaggtggcg
gtcataggtcccgcgggggagaacctatccctcatagccaacatcataaacgacaagcac
cgggcaccaggccggggcggcatgggggcggtcatgggggccaagaaccttaaggccctg
gtggtgaggggcaccaagggggtctccgtggcggaccgggaggccttcatgagggcagtc
aaggtggcccgggagaagcttgcccaacacccggtcaccggatccggccttcccctctac
ggcaccaacgtgctggtcaacatccttaaccagaatggcggcctcccaacccgcaacttc
cgggagggggtctttgagggggcggacaagataagcggcgaggcccagcgggaggggcgg
ctcttgaggaacaagggctgcttcggctgctccatcggctgcggccgggtctccttcgcg
gagggttacgaccaccacggggagggcccggagtacgagaccagctggtccttcggagcg
gactgcggggtggacgacatcgacgcggtggccatggccaactaccggtgcaacgagctg
gggctggacaccatatccatggggtccaccatagcctgcgccatggagctctacgagatg
gggctcataaccaaggagatggcggggctggagttgcgcttcggtaacaaggacgccctg
gtccccatggtggaggcggcggcccacaagaggggcaagataggggagctactctccatg
ggatcctaccggttggccagccactttgggcacccggagctgtccatgacctccaagaag
caggagatgcctgcctacgaccccagggccatccagggcataggcctgaactacgccacc
agcaaccggggggcctgccacgtcaggggctacaccatatcccccgagatcctgggggtt
cctcagaagctggatccccagtcgacagaggataagcccacctgggacaaggtcttccag
gacctgaccgccgcggttgactcggtgggcatgtgtctgttcaccaccttcggtataggg
gccgaggagatagcggatcagctatccgccgccaccgggatagactactcggtggatgcc
cttatgaaggcgggagagcggatatggaacatggaacgtctcttcaacctaaaggagggc
ttcacttccgcggacgattcgctgccccccaggatgacccaggagccgttgccccatggg
ccccacaagggcaaggtgagccgggtgccggagatgctgcccagatactacgatgccagg
ggctggaccagcgacggggtcccaaccgaggataagatcagggagctgggactccagtgg
gcccggtga

DBGET integrated database retrieval system