KEGG   Thermanaerovibrio acidaminovorans: Taci_0503Help
Entry
Taci_0503         CDS       T01129                                 

Definition
(RefSeq) RecD/TraA family helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Taci_0503
Enzymes [BR:tai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Taci_0503
DNA repair and recombination proteins [BR:tai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Taci_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 HHH_2 HHH Helicase_RecD HHH_3 PhoH PIF1 NTPase_1 AAA_28 AAA_22 T2SSE ATPase AAA_16 UvrD_C DUF2075 UvrD-helicase IstB_IS21 AAA_23 DUF1953 ABC_ATPase cobW AAA_18
Motif
Other DBs
NCBI-GeneID: 8630314
NCBI-ProteinID: YP_003317021
UniProt: D1B8Y6
Position
536701..538848
Genome map
AA seq 715 aa AA seqDB search
MLQRLEGEVLEVSYRDQVTGYTVASVVVSDGQVVTVVGAFPLPMAGERLVMEGRWTVHRR
YGRQFCAEDVRMAMPSSLEGLVRYLSSGVIPKVGPSTARRIVEHFKEETLDVLDNRVERL
LEIPGIGPKRVEEVRLHWEEHRRRRQAVLQLLDFGIGSALADRIVRIYGDLAAEVVRSNP
YQLAYDVAGIGFVTADRIAQRVGICRDAPERLDAGILFSMRRAVEEGHSMLPWDELLQRS
RRLLAVDSGVEDRLELLCTLGMLEAEELGGLRCVYLPGLRRAEAASAGAVRDMAASSGAR
LGWELEGMITALEGQFGIRLEEPQRRAVKGALSHRIFVITGGPGTGKTTLLRFTVRLCQM
MGLRVLLAAPTGRAAKRMAEVTRVEAYTLHRALEYDPRSNRFGRGRSRPLEADVVIVDEF
SMVDLPMFHRLLSGIGEDASLVLVGDSNQLPSIGPGSVLKDLISSGSVPKVELKEIFRQA
QRSLIIRNSYRILEGGTLELPPLSQGLDVAFVEEDDPSLAAEAVVDLVGYEIPRCTGLSP
WDVQVLTPMHKGEAGARNLCLRLQEVLNPSGERLRRGEGGFRRGDKVIQLKNDYDLEIYN
GDIGVVEGQVDQGLLVDFEGRRVQIRREAEVNLALAYALTIHKSQGSEYPAVVVPLLDQH
FVMLKRNLLYTALTRAKRLAVLVGSRRAIERAVSTQEGNARYGALRWRLAKREEA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
ttgctccagcgccttgagggggaggtgttggaggtctcctatcgggaccaggttacgggc
tacacggtggcctcggtggtggtctccgatgggcaggtggttaccgtggtgggggccttc
ccgctccccatggcgggggagcggctggtcatggagggccgttggaccgttcaccggcgc
tacggccggcagttttgtgccgaggacgtgcggatggccatgccctcctccctggagggg
ctggttcgctacctctcctccggggtgatacccaaggtgggcccctccaccgcccggagg
atagtggagcacttcaaggaggagacccttgacgtgctggacaaccgggtggaacgcctt
ctggagatacccgggatagggcccaagcgggtggaggaggttcgcctgcattgggaggag
caccgccggaggcgtcaggcggtgctccagttgctggatttcggcataggctccgccctg
gcggaccggatagtccgcatctacggggacctggcggcggaggtggtcagatctaacccc
taccagctggcctacgacgtggcgggcatagggttcgtcaccgccgacaggatagcccag
cgggttggcatatgccgggatgcgccggagaggctggatgcggggatcctcttctccatg
aggagggcggtggaggaggggcactccatgttgccctgggatgagctgctccagcgctcc
cgtcggctcctggcggtggactccggggtggaggataggctcgagcttctctgcaccctg
ggcatgctggaggccgaggagcttggggggctcaggtgcgtttacctgccgggcctccgc
agggcggaggccgcctccgccggggcggtgcgcgacatggccgcgtcctcgggggcgagg
ctgggctgggagctggaggggatgataaccgccctggaggggcagttcggcataaggctg
gaggagccccagcgccgggcggtgaagggggccctctcccaccggatcttcgtcataacc
ggtggacccgggaccggaaagaccacccttctcaggttcaccgtgaggttatgccagatg
atgggccttcgggtgcttcttgcggcccccaccggcagggcggcgaagcggatggcggag
gtcaccagggtggaggcctacaccctgcatcgggccctggagtacgaccccaggtccaac
cgcttcggaagggggcgcagcagacccctggaggcggacgtggtgatcgtggacgagttc
tccatggtggacctccccatgtttcaccgcctcctgagcggcatcggggaggatgcctcc
ctggtcctggtgggggactcgaaccagctcccctccataggtcccggcagcgtcctcaag
gacctcatatcctccggatcggtccccaaggtggagctcaaggagatctttaggcaggcc
cagaggagcctaataatccggaactcctaccggatcctcgaagggggtaccctggagcta
ccacccctatcgcaggggcttgacgtggcctttgtggaggaggatgatccgtccctggcg
gcggaggcggtggtggacctggtgggctacgagatcccccggtgcaccggcctgtcgccc
tgggacgtgcaggtgctcacccccatgcataagggggaggcgggggcgaggaacctttgc
ctgcgcctccaggaggtgcttaacccctctggggagaggctccgccggggagagggggga
ttcaggcggggggacaaggtgatacagctcaagaacgactacgaccttgagatatacaac
ggcgacataggagtggtggagggacaggtggaccaggggctcctggtggacttcgagggg
cgaagggttcagatccgccgggaggcggaggtcaacctggcgttggcctatgcgctcacc
atccacaagtcccaggggagcgagtacccggcggtggtggtccccctgttggaccagcac
tttgttatgttgaagcgaaacctgctgtacaccgctttgacccgggccaagcggttggcg
gtcctggtggggtccaggagggccatagagagggcggtatccacccaggaaggcaacgcc
aggtatggggcgctaaggtggcgcctcgccaagagggaggaagcttga

DBGET integrated database retrieval system