KEGG   Thermanaerovibrio acidaminovorans: Taci_0503Help
Entry
Taci_0503         CDS       T01129                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Taci_0503
Enzymes [BR:tai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Taci_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536701..538848
Genome map
AA seq 715 aa AA seqDB search
MLQRLEGEVLEVSYRDQVTGYTVASVVVSDGQVVTVVGAFPLPMAGERLVMEGRWTVHRR
YGRQFCAEDVRMAMPSSLEGLVRYLSSGVIPKVGPSTARRIVEHFKEETLDVLDNRVERL
LEIPGIGPKRVEEVRLHWEEHRRRRQAVLQLLDFGIGSALADRIVRIYGDLAAEVVRSNP
YQLAYDVAGIGFVTADRIAQRVGICRDAPERLDAGILFSMRRAVEEGHSMLPWDELLQRS
RRLLAVDSGVEDRLELLCTLGMLEAEELGGLRCVYLPGLRRAEAASAGAVRDMAASSGAR
LGWELEGMITALEGQFGIRLEEPQRRAVKGALSHRIFVITGGPGTGKTTLLRFTVRLCQM
MGLRVLLAAPTGRAAKRMAEVTRVEAYTLHRALEYDPRSNRFGRGRSRPLEADVVIVDEF
SMVDLPMFHRLLSGIGEDASLVLVGDSNQLPSIGPGSVLKDLISSGSVPKVELKEIFRQA
QRSLIIRNSYRILEGGTLELPPLSQGLDVAFVEEDDPSLAAEAVVDLVGYEIPRCTGLSP
WDVQVLTPMHKGEAGARNLCLRLQEVLNPSGERLRRGEGGFRRGDKVIQLKNDYDLEIYN
GDIGVVEGQVDQGLLVDFEGRRVQIRREAEVNLALAYALTIHKSQGSEYPAVVVPLLDQH
FVMLKRNLLYTALTRAKRLAVLVGSRRAIERAVSTQEGNARYGALRWRLAKREEA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
ttgctccagcgccttgagggggaggtgttggaggtctcctatcgggaccaggttacgggc
tacacggtggcctcggtggtggtctccgatgggcaggtggttaccgtggtgggggccttc
ccgctccccatggcgggggagcggctggtcatggagggccgttggaccgttcaccggcgc
tacggccggcagttttgtgccgaggacgtgcggatggccatgccctcctccctggagggg
ctggttcgctacctctcctccggggtgatacccaaggtgggcccctccaccgcccggagg
atagtggagcacttcaaggaggagacccttgacgtgctggacaaccgggtggaacgcctt
ctggagatacccgggatagggcccaagcgggtggaggaggttcgcctgcattgggaggag
caccgccggaggcgtcaggcggtgctccagttgctggatttcggcataggctccgccctg
gcggaccggatagtccgcatctacggggacctggcggcggaggtggtcagatctaacccc
taccagctggcctacgacgtggcgggcatagggttcgtcaccgccgacaggatagcccag
cgggttggcatatgccgggatgcgccggagaggctggatgcggggatcctcttctccatg
aggagggcggtggaggaggggcactccatgttgccctgggatgagctgctccagcgctcc
cgtcggctcctggcggtggactccggggtggaggataggctcgagcttctctgcaccctg
ggcatgctggaggccgaggagcttggggggctcaggtgcgtttacctgccgggcctccgc
agggcggaggccgcctccgccggggcggtgcgcgacatggccgcgtcctcgggggcgagg
ctgggctgggagctggaggggatgataaccgccctggaggggcagttcggcataaggctg
gaggagccccagcgccgggcggtgaagggggccctctcccaccggatcttcgtcataacc
ggtggacccgggaccggaaagaccacccttctcaggttcaccgtgaggttatgccagatg
atgggccttcgggtgcttcttgcggcccccaccggcagggcggcgaagcggatggcggag
gtcaccagggtggaggcctacaccctgcatcgggccctggagtacgaccccaggtccaac
cgcttcggaagggggcgcagcagacccctggaggcggacgtggtgatcgtggacgagttc
tccatggtggacctccccatgtttcaccgcctcctgagcggcatcggggaggatgcctcc
ctggtcctggtgggggactcgaaccagctcccctccataggtcccggcagcgtcctcaag
gacctcatatcctccggatcggtccccaaggtggagctcaaggagatctttaggcaggcc
cagaggagcctaataatccggaactcctaccggatcctcgaagggggtaccctggagcta
ccacccctatcgcaggggcttgacgtggcctttgtggaggaggatgatccgtccctggcg
gcggaggcggtggtggacctggtgggctacgagatcccccggtgcaccggcctgtcgccc
tgggacgtgcaggtgctcacccccatgcataagggggaggcgggggcgaggaacctttgc
ctgcgcctccaggaggtgcttaacccctctggggagaggctccgccggggagagggggga
ttcaggcggggggacaaggtgatacagctcaagaacgactacgaccttgagatatacaac
ggcgacataggagtggtggagggacaggtggaccaggggctcctggtggacttcgagggg
cgaagggttcagatccgccgggaggcggaggtcaacctggcgttggcctatgcgctcacc
atccacaagtcccaggggagcgagtacccggcggtggtggtccccctgttggaccagcac
tttgttatgttgaagcgaaacctgctgtacaccgctttgacccgggccaagcggttggcg
gtcctggtggggtccaggagggccatagagagggcggtatccacccaggaaggcaacgcc
aggtatggggcgctaaggtggcgcctcgccaagagggaggaagcttga

DBGET integrated database retrieval system