KEGG   Thermanaerovibrio acidaminovorans: Taci_0535Help
Entry
Taci_0535         CDS       T01129                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Taci_0535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_0535
   00052 Galactose metabolism
    Taci_0535
   00500 Starch and sucrose metabolism
    Taci_0535
   00520 Amino sugar and nucleotide sugar metabolism
    Taci_0535
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Taci_0535
   00524 Butirosin and neomycin biosynthesis
    Taci_0535
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Taci_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570561..571451
Genome map
AA seq 296 aa AA seqDB search
MECSLRIAVDVGGHTVTVGLVDAGSFQVLGHVSHPTPEGGSVAPLARLIRREASRLCGDA
GVSIPDQVRMAVPGMLSRERDRILKAPNVPGLDGVWLRQVRSALEGEMGGPVRVLWENDA
NCYALGEWARGVARGMGDLVLFTLGTGIGCGIILGGRLLIGSRGMAGEAGHLVVRDGGRC
GCGGVGHLEAHSGTGAVEALGGGDFRSLWEEFRAGVSRTEVESFLDGLARGMASVFHLLD
PQAVVLGGGASRAEGLLEELLPRMGAYLAEPFRGSVRVLISQLGDLAPLIGAAALG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttggagtgctcgcttcgcatcgcggttgacgttgggggccacacggtgaccgttgggttg
gtggatgccgggtccttccaggttctgggccacgtgagccatcccacaccggaggggggt
agtgtggccccgttggcgcggttgatccgccgggaggcttcgaggctctgcggggatgcg
ggggtatcgattccggaccaggtgcgcatggcggtgccggggatgctgtcccgggagagg
gaccggatcctcaaggcccccaacgtgccggggctggacggggtctggcttcggcaggtg
cgctccgccttggagggggagatgggcggcccagtccgggtgctctgggagaacgacgcc
aactgctacgccctgggggagtgggccaggggggtggcccgggggatgggggacctggtc
ctctttacgctggggaccggcattgggtgcgggatcatcctgggcggcaggctcctgatc
ggtagccgtggcatggcgggggaggcggggcatctggtggtccgggacggtgggcgttgc
ggatgcggcggcgtggggcacctggaggcccattccggcaccggggcggtggaggccctg
gggggcggggacttcaggtccctttgggaggagttcagggctggggttagccgtaccgag
gtggagtccttcctggacggcctggcccgggggatggcgtcggtttttcatctgctggac
ccccaggcggtggtgctgggcggcggcgcatctcgggcggaggggctactcgaggagctg
ctcccccggatgggggcgtaccttgcggagcccttccgggggagcgtgagggtgctcata
tcccagctgggggacctggcccccctgatcggcgcggcggcgttgggctga

DBGET integrated database retrieval system