KEGG   Thermanaerovibrio acidaminovorans: Taci_0641Help
Entry
Taci_0641         CDS       T01129                                 

Definition
(RefSeq) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00300  Lysine biosynthesis
tai01100  Metabolic pathways
tai01120  Microbial metabolism in diverse environments
tai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Taci_0641
Enzymes [BR:tai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Taci_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Nuc_rec_co-act
Motif
Other DBs
NCBI-GeneID: 8630455
NCBI-ProteinID: YP_003317159
UniProt: D1B9C4
Position
674766..676001
Genome map
AA seq 411 aa AA seqDB search
MSRFCGDPLDDKVLAYEGAMVEALCGLVRRPAISPDDGGLGEYDKALYIESLVSSLGLGP
VEMYGSPDPRAKGGVRPNLVLRVPGSYRDLPRLWIFTHMDVVPEGDRGLWESDPFEPVVR
DGMVIGRGANDNGQELVASLFALKAVVDQGGPGREVCLAFVADEEVGSEHGIGFLMREHR
DLFSPSDLVLVPDGGNEAGDFIEVAEKTILWVEFQVLGRQVHASRPDQGINACRVANELS
VNLDRALRSAFPESDPLFEPAISTFEPTRRLQNVANVNTVPGREVFALDCRVLPHVPVSE
VEKVIAAEVRKVEDAYGAKVSHRFLQKGDPTPVTDPASPVVELLTRSVQSVLGVSPRVGG
IGGGTCAAFFRANGIPAAVWAQETDTAHMPGEYALVEHMLNEARVFARMFA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagattctgtggcgatccgttggacgataaggtcttggcctacgagggggccatg
gtggaggccctgtgcgggctggtgaggcgtcctgccatatcccccgatgacggcggtcta
ggggagtatgacaaggcgctctacatcgagtccctggtgtcctctctgggcctgggtccc
gtggagatgtacggctcgccggatcctagggccaaggggggcgtgaggcccaacctggtg
ctaagggtgccggggagctaccgggaccttccgcggctttggatcttcacccacatggac
gtggtccccgagggggaccggggcctatgggagtcggatcccttcgagccggtggtgagg
gacgggatggtgatcggccggggggccaacgacaacggtcaggagctggtggcgtccctc
ttcgccctcaaggcggtggtggaccaggggggacccgggcgggaggtgtgtctcgccttc
gtggcggacgaggaggtgggtagcgagcacggcatcggcttcctcatgagggagcatcgg
gacctgttctccccctccgacctggtcctggtgcccgatggtgggaacgaggcaggggac
ttcatcgaggtggcggagaagaccatcctatgggtcgagttccaggtgctgggccgtcag
gtccacgccagccgccccgatcaggggatcaacgcctgccgggtggccaacgagctgtcg
gtgaacctggacagggccttgaggagcgcgtttcccgagtcggaccccctcttcgagccc
gcgatatccaccttcgagcccaccaggcgacttcagaacgtggccaacgtgaacaccgtg
ccggggagggaggtcttcgccctggactgtcgggtgctgccccacgtgccggtgtctgag
gtggagaaggtgatcgccgccgaggtccgtaaggtggaggacgcctacggggccaaggtc
tcccaccggttcctccagaagggggatcccacgccggtgaccgatcccgcctccccggtg
gtggagcttttgacccggtcggttcagtcggtcctgggggtaagcccccgggtggggggc
atagggggcggcacctgcgccgccttcttcagggccaacggcatccctgcggcggtctgg
gcccaggagaccgacacggcccacatgcccggcgagtacgccctggtggagcacatgctg
aacgaggccagggtcttcgcccggatgtttgcttaa

DBGET integrated database retrieval system