KEGG   Thermanaerovibrio acidaminovorans: Taci_0771Help
Entry
Taci_0771         CDS       T01129                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Taci_0771
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Taci_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805329..806192
Genome map
AA seq 287 aa AA seqDB search
MEFIVPCHIKINLCLWVGAPGVDGYHPIRTFFLKLRSPEFLRIRTGSVRTVVYHRGDPFY
GEHLVLRAQALLRGRIQLPPVEVECEKALPAGGGVGGGSGNAGAFIRWAYAQAGMDTDLS
VAAQLGSDVAFLASRMWAAWGEGRGELLTPPEGDLDGLRELRGIIGFPRWAIGTAWAYRM
LDQLRGSSSDARLPEGGEVEPLLEGLVRGRVVGLMSNDFIPVAEKVRPEYVKIWRDCESL
GALAWGLCGSGSGFFALFSHQEGVERAFAELGKQDYVRSLIPLEVCR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttggagttcattgtgccctgtcacataaagatcaacctatgcctttgggttggggcacct
ggggtggatggttatcaccccatcaggaccttcttcctcaagctgaggtccccggagttc
ctccggataaggacgggttctgtgaggaccgtggtctaccatcggggggatccgttctac
ggggagcacctggtcttacgggcacaggccctgctccggggccggatccagctccccccg
gttgaggttgagtgtgagaaggcgttgccggcgggcggcggggtcggcggtgggagtggc
aacgccggggccttcatccgttgggcctacgcccaggcggggatggatacggacctttcg
gtggccgcccagttgggcagcgacgtggccttcctggcctctcgtatgtgggccgcctgg
ggggaggggaggggggagctgttgaccccccctgagggagaccttgatgggttgagggag
ctgagggggataatcggcttccctcgctgggcgatcgggaccgcctgggcctatcggatg
ctggaccagctcaggggatcatcctctgatgcgcgtctgccggagggtggggaggtggag
cccctgctggaggggctggttcgggggcgtgtggtgggcctaatgtcgaacgatttcatc
cccgtggcggagaaagtcaggccagagtacgttaaaatatggcgggactgcgagtccttg
ggggccctcgcctgggggctgtgtggcagcggcagcggcttcttcgccctgttctcccac
caggagggggtggagagggcgtttgcggagcttggcaagcaggattacgtaaggagtctt
atcccattggaggtctgtagatga

DBGET integrated database retrieval system