KEGG   Thermanaerovibrio acidaminovorans: Taci_0785Help
Entry
Taci_0785         CDS       T01129                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Taci_0785
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Taci_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815733..816338
Genome map
AA seq 201 aa AA seqDB search
MGNDKIGNYRRGTLFVISGPSGAGKGTLRRVLFERVPGLFYSVSYTTRSPRPGETDGVDY
RFVSEEEFKRMIEEGAFLEWAFVHGKYYGTNLKDIEAKLSEGYDVVLEIDVQGAQQVTRK
VPGAVTIFVEPPSVEELEHRLHGRGTEGEDELSLRLRNAMDELSHAGEYQYRIVNDRVED
AAETLVKIIEQTRRSRGGMSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgataagataggcaactacaggagggggaccctgtttgtcatatcgggtccc
agcggagcgggcaaggggacgttgcggcgggtcctcttcgaacgggtgccggggctcttc
tactcggtctcctacaccaccaggtcgccccgcccgggggagaccgatggggttgattat
cgcttcgtctccgaggaggagttcaaacggatgatcgaagagggggccttcctggaatgg
gcctttgtccacggcaagtactacggcaccaaccttaaggacatagaggccaagctcagc
gaggggtacgatgtggtcctggagatagacgttcagggggcccagcaggttacccgaaag
gtccctggggcggtgaccatatttgtggagcccccgtcggtggaggagcttgagcatcgc
ctccacggccggggcaccgagggggaggacgagctatcccttcgcttgaggaacgccatg
gacgagctatcccacgcgggggagtaccagtacaggatagtcaacgaccgggtggaggac
gcggccgaaaccctggttaagataatagagcagaccaggagatcaaggggaggtatgtct
aagtga

DBGET integrated database retrieval system