KEGG   Thermanaerovibrio acidaminovorans: Taci_0840Help
Entry
Taci_0840         CDS       T01129                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Taci_0840
   00052 Galactose metabolism
    Taci_0840
   00500 Starch and sucrose metabolism
    Taci_0840
   00520 Amino sugar and nucleotide sugar metabolism
    Taci_0840
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Taci_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873617..874498
Genome map
AA seq 293 aa AA seqDB search
MGCSSAPLRHCLFPVAGLGTRFLPATKETPKEMLPLIDRPLIHYGVEEACGAGCRDVVFV
TGRGKRSIEDYFDRSPDLEGLLETRGKLDLAEMVRGISEMARFSYVRQSEPLGLGHAVLC
GRTCCNGDHFGVILPDDVILSHVPVLAQLDQVRLRFGGSVLALEEVSEEDTSRYGIVDAE
DLGGGVFRIRDLVEKPDPKDAPSRLAIMGRYVLSSRIFDHLERVLPGSGGEIQLTDGLKS
LLSEEPIYGYIYQGERLDCGTKEGWLKATVTMALRDRGLREIVMDVLRSEGVI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggatgttctagcgctccgttgaggcactgccttttcccggttgctggtctaggtacc
cggttccttcccgccaccaaggagacccccaaggagatgctgcctcttatagatcgaccc
ctgatccactacggggtggaggaggcgtgtggcgccgggtgcagggacgtggtgttcgtg
accggcaggggcaagcggtccatcgaggactacttcgacaggtccccggacctggagggg
ctccttgagaccaggggaaagttggacctggcggagatggttaggggcataagcgagatg
gcccggttctcctatgtcaggcagtcggagcccctggggctaggtcacgcggtgctctgc
ggaaggacctgttgcaacggggatcacttcggcgtcatacttcccgacgacgtgatcctc
tcccatgtcccagtcctggctcagctggaccaggtcaggctccggttcggcggctccgtg
cttgcccttgaggaggtttcggaggaggacacctccaggtacggcatcgttgacgcggag
gacctggggggaggggttttcaggataagggacctggtggagaagccggatcccaaggat
gcccccagcaggttggccataatgggacggtacgtgctgtccagccggatcttcgatcac
ttggagcgggtcttacccggttccggcggagagatacagctgaccgacggtctgaaatcg
ctcctctcggaggagcccatctatgggtacatctatcagggagagcgacttgactgcggt
accaaggaggggtggctcaaggccacggtcaccatggccctgagggatcgggggttgcgg
gagatagtgatggatgtcctccgatcggagggggtgatttaa

DBGET integrated database retrieval system