KEGG   Thermanaerovibrio acidaminovorans: Taci_0840Help
Entry
Taci_0840         CDS       T01129                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Taci_0840
   00052 Galactose metabolism
    Taci_0840
   00500 Starch and sucrose metabolism
    Taci_0840
   00520 Amino sugar and nucleotide sugar metabolism
    Taci_0840
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Taci_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873617..874498
Genome map
AA seq 293 aa AA seqDB search
MGCSSAPLRHCLFPVAGLGTRFLPATKETPKEMLPLIDRPLIHYGVEEACGAGCRDVVFV
TGRGKRSIEDYFDRSPDLEGLLETRGKLDLAEMVRGISEMARFSYVRQSEPLGLGHAVLC
GRTCCNGDHFGVILPDDVILSHVPVLAQLDQVRLRFGGSVLALEEVSEEDTSRYGIVDAE
DLGGGVFRIRDLVEKPDPKDAPSRLAIMGRYVLSSRIFDHLERVLPGSGGEIQLTDGLKS
LLSEEPIYGYIYQGERLDCGTKEGWLKATVTMALRDRGLREIVMDVLRSEGVI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggatgttctagcgctccgttgaggcactgccttttcccggttgctggtctaggtacc
cggttccttcccgccaccaaggagacccccaaggagatgctgcctcttatagatcgaccc
ctgatccactacggggtggaggaggcgtgtggcgccgggtgcagggacgtggtgttcgtg
accggcaggggcaagcggtccatcgaggactacttcgacaggtccccggacctggagggg
ctccttgagaccaggggaaagttggacctggcggagatggttaggggcataagcgagatg
gcccggttctcctatgtcaggcagtcggagcccctggggctaggtcacgcggtgctctgc
ggaaggacctgttgcaacggggatcacttcggcgtcatacttcccgacgacgtgatcctc
tcccatgtcccagtcctggctcagctggaccaggtcaggctccggttcggcggctccgtg
cttgcccttgaggaggtttcggaggaggacacctccaggtacggcatcgttgacgcggag
gacctggggggaggggttttcaggataagggacctggtggagaagccggatcccaaggat
gcccccagcaggttggccataatgggacggtacgtgctgtccagccggatcttcgatcac
ttggagcgggtcttacccggttccggcggagagatacagctgaccgacggtctgaaatcg
ctcctctcggaggagcccatctatgggtacatctatcagggagagcgacttgactgcggt
accaaggaggggtggctcaaggccacggtcaccatggccctgagggatcgggggttgcgg
gagatagtgatggatgtcctccgatcggagggggtgatttaa

DBGET integrated database retrieval system