KEGG   Thermanaerovibrio acidaminovorans: Taci_0923Help
Entry
Taci_0923         CDS       T01129                                 

Definition
RuvA domain-containing protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Taci_0923
Enzymes [BR:tai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Taci_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965058..965642)
Genome map
AA seq 194 aa AA seqDB search
MIRYLVGVVEELVGDLMVVQVGGVGVEVTGTRAALEMASPGESIRLPVYLSVSDSGISLY
GFGDDHERRVFLLLLQASGVGCKMAMGILNSMDKGEVLDAIASGDVARISRAQGVGPKRA
ERICFELKDKVTSLGIPRGNSGALVSTGSILEALMGLGFSRGEAAMALGEVRSKGEDLPE
DQLLLRALRVLQRR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgataagatacctggttggggtggttgaggagctggtgggggatctgatggtcgtccag
gtggggggcgtcggtgtcgaggtgaccggcacccgcgcggccctggagatggcctctcca
ggggagtccataaggctcccggtctacctttccgtaagcgacagcgggatatccctttac
ggatttggggatgaccacgagaggagggtgttcctgctattgttgcaggccagtggggtg
ggctgcaagatggccatgggaatactgaactccatggacaagggcgaagtgctggatgcc
atagcctccggtgacgtggccaggatctccagggcccagggggttggtcccaagagggcg
gagaggatatgctttgagctcaaggacaaggtgacatccctagggatccccagggggaat
tcgggggcgttggtttccaccggctccatattggaggccctcatggggcttggcttctcc
aggggggaggccgccatggcgctgggggaggtgcgatccaagggggaggatctgccggag
gaccagcttctcctgagggcccttagggtcctccagaggaggtga

DBGET integrated database retrieval system