KEGG   Thermanaerovibrio acidaminovorans: Taci_1003Help
Entry
Taci_1003         CDS       T01129                                 

Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Taci_1003
DNA repair and recombination proteins [BR:tai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Taci_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046055..1046657)
Genome map
AA seq 200 aa AA seqDB search
MAGVGIPSVDGLIEKLKRLPGVGEKGARRFAFFILGQPKDWVEDLSRAIREARWSVRPCS
VCGGLAEGDLCPICSDPARDREVICVVESQEDCVAMERHRIFNGRYHVLGGRYSPLDGED
IPSEALASLRDRVERGGVQEVILALAPSVEGELTALAVKEALDDLPVKVSRLSSGLPVGG
SIGFADSATLKLALEGRRGM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggggtaggcataccgtcggtagatggcctgatcgagaagctgaagaggttgccc
ggggtgggtgagaagggggcccggcggttcgccttcttcatcctggggcagcccaaggat
tgggtggaggatctgtcccgggccatccgggaggcccgttggtccgtcaggccctgtagc
gtgtgtgggggcctggcggagggggacctgtgccccatatgttcagatccggctcgtgac
cgggaggtaatctgcgtggtggagtcccaggaggactgcgtggccatggagaggcaccgg
atcttcaacggaaggtaccacgtcctggggggcaggtactcccccctggacggggaggat
ataccgtcggaggcgttggcctcactgcgcgatagggtggagagagggggggttcaggag
gttatcctggccctggccccaagcgttgagggggagctgaccgccctggcggtgaaggag
gccctggacgacctgccggtcaaggtctccaggctctcctccggtctgcccgttgggggc
agcataggtttcgccgacagcgccaccctgaagttggcgttggagggcaggcggggcatg
tga

DBGET integrated database retrieval system