KEGG   Thermanaerovibrio acidaminovorans: Taci_1092Help
Entry
Taci_1092         CDS       T01129                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tai00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tai00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149870..1150820)
Genome map
AA seq 316 aa AA seqDB search
MTGTDVRCVRWTRRHVLDVEGWSRDEIYMLLEQARHMEDLLSRPIKKVPALRGKLAVNLF
FENSTRTRVSFELAEKMLSADVVNWSSSGSSTAKGETLRDTAWTLEAMGADVVVIRHGAV
GAASYLASKLKRAVVMNAGDGAHAHPTQCLLDLYTAWKHLGDLEGKRVAIVGDVEHSRVA
RSDIIGFRTLGCQVTLSGPSTLMPFQVDHLGVQYERDVRRATEGADVIYLLRIQRERQQD
GLFPSVDEYHRFWGATEELVREVNPKALVMHPGPINRGVEIESALADGENSVILEQVRSG
VAVRMALLYLCAGGVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggactgacgtgaggtgcgttaggtggaccaggcggcacgtgcttgacgtggag
ggctggagcagggacgagatctacatgctcctcgagcaggccaggcacatggaggacctc
ctgtccaggcccatcaagaaggtccccgccctgcgggggaagctggcggttaacctcttc
ttcgagaactccaccaggacccgggtctccttcgagctggcggagaagatgctctctgcc
gacgtggtcaactggtcgagctctggttccagcactgccaagggggagaccctgagggac
accgcctggaccctggaggccatgggggccgacgtggtggtcataaggcacggggcggtg
ggggctgcctcatacctggccagcaagctcaagcgggcggtggtgatgaacgccggggac
ggggcccacgcccaccccacccagtgcctgctggacctctacaccgcctggaagcacctg
ggggacctggaggggaagcgggtggccatcgtgggggacgtggagcacagccgggttgcc
cggagcgacatcatagggttcaggaccctgggctgccaggtgaccctatcggggccctcc
accctgatgcccttccaagttgatcacctgggggtccagtacgagagggatgtccgcagg
gccaccgagggggcggacgtgatctacctgctcaggatccagcgggagaggcagcaggac
gggctcttcccctccgtggacgagtaccaccggttctggggcgccacggaggagctggtg
agggaggtcaacccaaaggcgttggtgatgcacccgggccccataaaccggggggttgag
atcgagagcgccctggcggacggggagaacagcgtgatccttgagcaggtccgaagcggc
gtggcggtccggatggccctgctctacctttgcgcgggaggtgtggcctga

DBGET integrated database retrieval system