KEGG   Thermanaerovibrio acidaminovorans: Taci_1258Help
Entry
Taci_1258         CDS       T01129                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Taci_1258
   01230 Biosynthesis of amino acids
    Taci_1258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_1258
   00030 Pentose phosphate pathway
    Taci_1258
   00051 Fructose and mannose metabolism
    Taci_1258
   00052 Galactose metabolism
    Taci_1258
  Energy metabolism
   00680 Methane metabolism
    Taci_1258
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Taci_1258
Protein phosphatases and associated proteins [BR:tai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Taci_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1308264..1309223)
Genome map
AA seq 319 aa AA seqDB search
MKRIAVLTSGGDSPGMNAAIRAVTRTAIYRGLDVIGFRRGYEGLLDGDGIPLTKSSVGGI
ILRGGTILRTARSERFRRPEGVNEAYARLKEYDIDALVVIGGDGSFRGAWRLHEIGFPVA
GIPGTIDNDIAGTDYTIGFDTACNTALEAVQKLRDTASSHDRLFIVEVMGRSAGFLALEV
GVASGAEYVLVPEVPFKIEDLCEKLRYARQRGKTHSMIILAEGVMSAGELASQLKDTGGY
EARITVLGHIQRGGAPSSFDAVLASRMGAAAVNSLIEGQRGFMVGYVNGKIVTPPMSTAW
EEKRPLNAEMMELVDCLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaggattgcggtgctgaccagcggcggagactcgccgggcatgaacgcggccata
agggcggtcaccaggaccgccatctaccggggccttgacgtcataggcttccggcgaggt
tacgagggtctccttgacggggatgggatccccctcaccaagagctccgtgggggggata
atccttcgggggggcaccatcctgaggaccgcccggagcgaacgtttccggcgccccgag
ggggtcaacgaggcctacgccaggctgaaggagtacgacatcgacgccctggtggtcata
gggggcgacggttccttccggggggcctggaggcttcacgagataggcttcccggtggcg
ggcataccgggcaccatcgacaacgacatagcggggaccgactacaccatcggtttcgac
accgcctgcaacaccgccctggaggcggttcagaagctgagggacaccgcttcgagccac
gaccggctcttcatcgtggaggtcatgggccggtccgcgggcttcctggcgctagaggtt
ggagtggcctccggggcggagtacgtgctggtgccggaggtgcccttcaagatcgaggac
ctgtgcgagaagctccgctacgcccggcagaggggcaagacccactccatgataatcctg
gcggagggggtcatgtccgccggggagctggcctcccagctgaaggacaccgggggttac
gaggcccggataaccgtgctggggcacatccagcggggaggggccccctcctccttcgat
gcggtcctggcgtcccggatgggggccgcggcggtgaactccctcatcgaaggccagagg
ggcttcatggtggggtacgtgaacggcaagatagtcaccccccccatgtccaccgcctgg
gaggagaagcgtcccctcaacgcggagatgatggagctggtggactgcctcagcatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system