KEGG   Thermanaerovibrio acidaminovorans: Taci_1258Help
Entry
Taci_1258         CDS       T01129                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tai01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tai01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tai00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tai00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tai00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tai00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tai00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1308264..1309223)
Genome map
AA seq 319 aa AA seqDB search
MKRIAVLTSGGDSPGMNAAIRAVTRTAIYRGLDVIGFRRGYEGLLDGDGIPLTKSSVGGI
ILRGGTILRTARSERFRRPEGVNEAYARLKEYDIDALVVIGGDGSFRGAWRLHEIGFPVA
GIPGTIDNDIAGTDYTIGFDTACNTALEAVQKLRDTASSHDRLFIVEVMGRSAGFLALEV
GVASGAEYVLVPEVPFKIEDLCEKLRYARQRGKTHSMIILAEGVMSAGELASQLKDTGGY
EARITVLGHIQRGGAPSSFDAVLASRMGAAAVNSLIEGQRGFMVGYVNGKIVTPPMSTAW
EEKRPLNAEMMELVDCLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaggattgcggtgctgaccagcggcggagactcgccgggcatgaacgcggccata
agggcggtcaccaggaccgccatctaccggggccttgacgtcataggcttccggcgaggt
tacgagggtctccttgacggggatgggatccccctcaccaagagctccgtgggggggata
atccttcgggggggcaccatcctgaggaccgcccggagcgaacgtttccggcgccccgag
ggggtcaacgaggcctacgccaggctgaaggagtacgacatcgacgccctggtggtcata
gggggcgacggttccttccggggggcctggaggcttcacgagataggcttcccggtggcg
ggcataccgggcaccatcgacaacgacatagcggggaccgactacaccatcggtttcgac
accgcctgcaacaccgccctggaggcggttcagaagctgagggacaccgcttcgagccac
gaccggctcttcatcgtggaggtcatgggccggtccgcgggcttcctggcgctagaggtt
ggagtggcctccggggcggagtacgtgctggtgccggaggtgcccttcaagatcgaggac
ctgtgcgagaagctccgctacgcccggcagaggggcaagacccactccatgataatcctg
gcggagggggtcatgtccgccggggagctggcctcccagctgaaggacaccgggggttac
gaggcccggataaccgtgctggggcacatccagcggggaggggccccctcctccttcgat
gcggtcctggcgtcccggatgggggccgcggcggtgaactccctcatcgaaggccagagg
ggcttcatggtggggtacgtgaacggcaagatagtcaccccccccatgtccaccgcctgg
gaggagaagcgtcccctcaacgcggagatgatggagctggtggactgcctcagcatatga

DBGET integrated database retrieval system