KEGG   Thermanaerovibrio acidaminovorans: Taci_1281Help
Entry
Taci_1281         CDS       T01129                                 

Definition
KpsF/GutQ family protein
Orthology
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
tai  Thermanaerovibrio acidaminovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335002..1336006)
Genome map
AA seq 334 aa AA seqDB search
MMLPYERDLSRVGDLELLEVGLQVIRQEARALEDGASRMGLELVRAARMVASCSGRVVVC
GLGKSGLIGRKIAATLASLGCPAFFLHAAEGSHGDLGMVCRDDVGLFLSNSGTTREVLEM
VPFFRRIGCPVIALTGRRDSPLGLSADVVLDCSVGREADPLGIAPTSSTTLQLAVGDALA
GMVTRLLGLRVEDFALFHPGGALGRRLLLRLEDVMAVGDRVPRVSRDASVKEALFAITDK
GYGAVAVEGPSGELVGIFTDGDLRRLMEREGVGSLERPVGEVMTRNPKVMGRDKLAAEAL
KLMEEMEISVVLVVDGARVEGIVHLHDLLKAGVA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgccctacgagcgggacctttcgagggtgggggacctggagctgttggaggtg
gggcttcaggtgatccggcaggaggcccgggcgttggaggatggggcatcgaggatgggg
ctcgagctggtcagggccgccaggatggtggcctcctgttccggccgggtggtggtctgt
ggccttgggaagtcggggctcataggccgcaagatcgccgccacattggcgtccctgggt
tgtcccgccttctttctgcacgctgctgagggatctcacggggacctggggatggtgtgc
cgggacgacgtggggctcttcctcagcaacagcggcaccacccgggaggttttggagatg
gtgcccttctttcgccggataggctgtcctgtgatagccctaacggggcgtagggactcc
ccccttgggctgtcggcggacgtggtgttggactgttcggtgggtcgggaggcggatccg
ttggggatcgcccccaccagcagcaccacccttcagctggcggtgggggacgccctggcg
gggatggtgacccggctgttgggccttcgggtggaggacttcgcccttttccaccccggg
ggtgcactggggaggaggttgctcctgcgcctggaggacgtgatggccgttggggaccgg
gtgccccgggtcagccgggacgcgtcggtcaaggaggccctcttcgccatcaccgacaag
ggttacggggcggtggcggtggaggggccctcgggggagctggtgggtatcttcaccgac
ggggacctgaggcgcctcatggagagggagggggtagggtccctggagaggcccgttggg
gaggtgatgacccggaaccccaaggtgatgggccgggacaagctggcggcggaggccctc
aagctcatggaggagatggagatatcggtggttttggtggttgatggtgcccgggtggag
gggatagttcacctgcatgacctcctgaaggcgggggtggcttga

DBGET integrated database retrieval system