KEGG   Thermanaerovibrio acidaminovorans: Taci_1311Help
Entry
Taci_1311         CDS       T01129                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tai00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Taci_1311
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Taci_1311
Enzymes [BR:tai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Taci_1311
Two-component system [BR:tai02022]
 CheA family
  CheA-CheYBV
   Taci_1311
Bacterial motility proteins [BR:tai02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Taci_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1364096..1365190)
Genome map
AA seq 364 aa AA seqDB search
MTTSRKIRVMVVDDSAFMRKVIGDILSSDGRFEVVARVRDGEEALQKLQEASPDVITLDV
EMPRKNGLEALKEIMERRPTPVVMVSSLTREGAEVTLQALSLGAVDFVTKPSGTISLDMN
KVEEELKQKVWVASTVDRSRLGLRRFPPERRPQPPVSQPSAPAAATAPRRRPQRVDLLLI
ASSTGGPRALQEVIPAIRKDFPCPVLVVQHMPRGFTASFAERLDDASQLKVVEGYDGLKP
QRGMAVIAPGGYHMVVDRSGADLVCRLSDAPPVRSVKPAADMLFMSVADVVGGSVVAAVL
TGMGRDGADGALALHRKGGIILAESPETCVVYGMPRAVVEAGIADEVIPLYEMPEAFHRW
TVGP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcagaaagataagggttatggtggtggacgactcggccttcatgcgcaag
gtcatcggcgacatcctttcctccgatggccgtttcgaggtggtggcccgggtcagggac
ggggaggaggcccttcagaagttgcaggaggcctcgccggacgtgataaccctggacgtg
gagatgccccggaagaacggcctggaggcgctcaaggagataatggagcggcgtcccacc
ccggtggtgatggtttccagcctgacccgggagggggcggaggtgacgttgcaggccctg
tcgctgggggcggtggatttcgtaaccaagccgtcgggcaccatatccctggacatgaac
aaggtggaggaggagctcaagcagaaggtctgggtggccagcacggtggaccggagccgg
ctcggccttcgcaggttccctccggagaggcggcctcagcccccggtgtcccagccctcc
gcccctgcggcggctacggcgcccaggaggaggccccagcgggtggatctgttgctcatc
gcctcctccaccggggggcccagggcccttcaggaggtgatccccgccataaggaaggac
ttcccctgtcccgtcctggtggttcagcacatgccccggggttttaccgcctccttcgcc
gagaggctggacgacgctagccagctgaaggtggtggagggctacgatggattaaaaccg
caaaggggtatggcggtgatagcccctggaggttatcatatggtggtggacagatccggt
gcggacctggtctgcagactctccgacgctccaccggtcagatccgtgaagcccgcggcg
gacatgttgttcatgagcgtggcggacgtggtgggcggttcggtggtggcggcggtcctg
accggcatgggcagggacggggcggacggagccctggcgctgcaccgaaagggagggata
atcttggcggagagcccagagacttgcgttgtctatggcatgcctagggcggtggtggag
gctggcatagcggacgaggtgatccctctctacgagatgccggaggcctttcatcgctgg
accgtgggtccttag

DBGET integrated database retrieval system