KEGG   Thermanaerovibrio acidaminovorans: Taci_1424Help
Entry
Taci_1424         CDS       T01129                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00010  Glycolysis / Gluconeogenesis
tai00260  Glycine, serine and threonine metabolism
tai00680  Methane metabolism
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01120  Microbial metabolism in diverse environments
tai01130  Biosynthesis of antibiotics
tai01200  Carbon metabolism
tai01230  Biosynthesis of amino acids
Module
tai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tai_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_1424
  Energy metabolism
   00680 Methane metabolism
    Taci_1424
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Taci_1424
Enzymes [BR:tai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Taci_1424
Membrane trafficking [BR:tai04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Taci_1424
Exosome [BR:tai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Taci_1424
  Exosomal proteins of melanoma cells
   Taci_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 8631281
NCBI-ProteinID: YP_003317936
UniProt: D1B6L3
Position
1478938..1479687
Genome map
AA seq 249 aa AA seqDB search
MYKIVLVRHGESQWNQENRFTGWTDVDLSPKGIEEARKAGRTLKEEGFTFDLAYTSVLKR
AIRTLWLIQEEMDLMWIPVKPSWRLNERHYGALQGLNKAETAEKYGEEQVKIWRRSYDVR
PPMLNQGDERDPILDPRYRDLPRELVPLGECLKDTVARVLPYWNDEIVPSLKEGRKVLLV
AHGNSIRALVKYLDNVSDQDILELNIPTGIPLLYELDENFKPISSRYLGDPEEIAKAQQA
VANQGKAKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgtacaagatagttctggtgcgacacggggagagtcagtggaaccaggagaaccggttc
accggctggaccgacgtggacctgtcccccaaggggatagaggaggcccggaaggcgggc
aggaccctcaaggaggagggcttcaccttcgacctggcctacacttcggtgctcaagcgg
gccatccggaccctgtggctcatccaggaggagatggatctcatgtggatccccgtcaag
ccctcctggagactgaacgagcgtcactatggagcgctgcaggggctcaacaaggcggag
accgcggagaagtacggggaggagcaggtaaagatctggcgcaggagctacgacgtgcgg
ccccccatgctgaaccagggggacgagagggaccccatcctggacccccgctacagggac
cttcccagggagctggtgcccctgggggagtgcctcaaggacacggtggcccgggtgctc
ccctactggaacgacgagatcgtcccttccctcaaggaggggcgcaaggtcctgctggtg
gcccacgggaacagcataagggccctggtcaagtacctggacaacgtgtccgaccaggac
atcctggagctcaacatccccaccggcatacccctcctctacgagctggacgagaacttc
aagcccatatccagccgctacctgggggacccggaggagatcgccaaggcccagcaggcg
gtggccaaccaggggaaggccaagaagtaa

DBGET integrated database retrieval system