KEGG   Thermanaerovibrio acidaminovorans: Taci_1444Help
Entry
Taci_1444         CDS       T01129                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Taci_1444
Enzymes [BR:tai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Taci_1444
    3.5.1.-  
     Taci_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501736..1502353
Genome map
AA seq 205 aa AA seqDB search
MRALLIVDVQYDFLPGGALPVPEGHLVIPAINSILDRFPLVVATQDWHPANHGSFASNHP
GRSPFETGELNGLPQVFWPDHCVQGSQGARISEEIPQERIQMILRKGTDPTVDSYSAFFD
NRRARPTGLCGYLKERGVRQVWIAGLAGDYCAYYSAVDASDLGFQVVFLEDATRPISPQG
FLKAKEDMARRGIRIANAGQLTWEE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcactcctgatcgtggacgtccagtacgatttcctgcccggcggagccctgccg
gtcccggagggccacctggtcatcccggccataaactccatcttggaccgcttccccctg
gtggtggccacccaagactggcacccggcaaaccacggaagcttcgcctccaaccacccg
ggaaggtcccccttcgagaccggggaactcaacggcctgccccaggtgttttggcccgac
cactgcgtccagggctcccaaggggcaaggatatccgaagaaataccccaggagcggatc
cagatgatccttcgaaagggcacggacccaacggtggacagctacagcgccttcttcgac
aaccgccgggccagacccaccggcctctgcggctacctcaaggaacggggggtccgccag
gtatggatagcgggcctggcgggagactactgcgcctactactccgcggtggacgcgtcg
gacctgggcttccaggtggtcttcctggaggacgccacccgccccataagcccccagggc
ttcctcaaggccaaggaggacatggccaggagggggatacggatcgcaaacgcagggcaa
ctcacatgggaggaatga

DBGET integrated database retrieval system