KEGG   Thermanaerovibrio acidaminovorans: Taci_1553Help
Entry
Taci_1553         CDS       T01129                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Taci_1553
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Taci_1553
Exosome [BR:tai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Taci_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1629356..1630885)
Genome map
AA seq 509 aa AA seqDB search
MSKKYVVAIDQGTTSTRCMVFDEKGLPVCSHQMEHVQIYPKPGWVEHDAMEIWSRTKDVI
RGALEKGEIDPNEIASIGITNQRETTVVWEKATGKPIYNAIVWQCMRTQDFCAEWQKVPG
WEQSRTGEGKVKDITGLLISPYFSGTKIKWILDNVPGARDRAAKGEILFGNIDTWLIWNL
TGGPDGGVHVTDVSNASRTLLMDIKTLQWSEEMASFLDVPLAMMPKIMPSSCVYGHTRAD
GPFGAEIPVAGDLGDQQAALFGQACFGKGDTKNTYGTGCFMLMNIGETPSPSKNGLLTTA
AYSLEEGKCVYALEGSIAITGAAVQWLRDNLRLFDEAPDSEYFASKVEDSGGIYFVPAFS
GLYAPYWDMSARGAIVGLTRYIRKEHIVRATLESICYQTRDVVEAMNKDSGVSLAELKVD
GGAVKNDLLMQMQADILGSKVVRPQVNETTALGAAYAAGLAVGFWKSTDELKEHWAEDRR
FDPLMSKERREEAYAGWKKAISKAQNWID
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaagaagtacgtggtggccatcgatcagggtactaccagcaccaggtgcatggtt
ttcgatgagaaggggttgccggtttgctcccatcagatggagcatgttcagatatacccc
aagcctggctgggttgagcacgatgccatggagatctggtccaggaccaaggacgtgatc
cggggagccctggagaagggggagatagatcccaacgagatagcctccataggcataacc
aaccagcgtgagactaccgtggtttgggagaaggccaccggcaagcccatctacaacgcc
atagtctggcagtgcatgaggacccaggacttctgcgccgaatggcagaaggttcccggt
tgggagcagtccaggaccggggaggggaaggtgaaggacataaccggtcttctcatcagc
ccctacttctccggcaccaagataaagtggatcttggacaacgtgcctggggctcgggac
agggctgccaagggtgagatcctcttcggcaacatagacacctggctcatctggaacctg
accggtggccccgacgggggtgtgcacgtgaccgacgtgtccaacgcctccaggacgctt
cttatggacatcaagaccctccagtggagcgaggagatggcctccttcctggacgtgccc
ctggcaatgatgcccaagataatgccctccagctgtgtgtatggtcacaccagggcggac
ggtccttttggggctgagatacccgtggcgggggacctgggggaccagcaggcggccctc
tttggccaggcctgtttcggcaagggggacaccaagaacacctacgggactgggtgcttc
atgctgatgaacataggggagaccccgtccccttccaagaacgggcttctgaccaccgcc
gcctacagtttggaggagggcaagtgcgtctacgccctggagggctccatcgccataacc
ggtgcggcggtccagtggctccgggacaacctgcggctcttcgatgaggcgccggacagc
gagtacttcgcctccaaggtggaggactccggcgggatatacttcgtccccgccttctcg
ggcctgtacgctccctactgggacatgagcgcccggggggccatcgtggggctcacccgc
tacatccgcaaggagcatatcgtaagggccaccctggagagcatctgctaccagaccagg
gacgtggtggaggccatgaacaaggactccggggtctctttggcggagctcaaggtggac
ggtggggcggtcaagaacgacctgctcatgcagatgcaggcggacatcctggggtccaag
gtggtgcgtccccaggtgaacgagaccaccgccctgggggccgcctacgcggcgggtctt
gcggtgggcttctggaagtccaccgacgagctgaaggagcactgggcggaggatcgccgc
ttcgatcccctcatgtccaaggagaggcgggaggaggcctacgcgggctggaagaaggcc
atatccaaggctcagaattggatcgactag

DBGET integrated database retrieval system