KEGG   Thermanaerovibrio acidaminovorans: Taci_1643Help
Entry
Taci_1643         CDS       T01129                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00010  Glycolysis / Gluconeogenesis
tai00071  Fatty acid degradation
tai00350  Tyrosine metabolism
tai00625  Chloroalkane and chloroalkene degradation
tai00626  Naphthalene degradation
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01120  Microbial metabolism in diverse environments
tai01130  Biosynthesis of antibiotics
tai01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_1643
  Lipid metabolism
   00071 Fatty acid degradation
    Taci_1643
  Amino acid metabolism
   00350 Tyrosine metabolism
    Taci_1643
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Taci_1643
   00626 Naphthalene degradation
    Taci_1643
Enzymes [BR:tai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Taci_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 8631513
NCBI-ProteinID: YP_003318139
UniProt: D1B766
Position
complement(1711918..1713099)
Genome map
AA seq 393 aa AA seqDB search
MKFEFYNPTRLIFGAGVLEKLGEAVRPLGGRALLVMGRGSARRSGLYDRVAGILSASGVS
VVPFEGVEPNPRLDTVLRGSEAARSEGCDVVVALGGGSVMDAAKVMAAGVFYPGDLWDMM
YVGPRRPRLPERALPIVTVPTLAATGSEMNDGAVITYQDLKVKAFVEAECLFPRVAVVDP
ELTLTVPRNQTAYGVSDIIAHVTEAYFNGVDGTPIQDSFAEGVLRAVVQWGPVAVEEGGN
LEARTQVQWASVVALNGWVQVGTRGAYPVHMMEHTLSGIHDVPHGAGLAVLNPAWMRFAA
PHRPERFAQFARNVFGVREEDHLTAAMRGIEALEDLLKRMGCPLTLGELGISDPDPELYA
RATLEVAGDREGMLRGRPGMSRLDLVGIFRSVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttcgagttctacaaccctacccggctgatcttcggcgccggcgttctggagaag
ttgggggaggcggttcgtccccttggcgggcgggccctgctggtgatggggcggggcagc
gcccgtcgcagcggcctttacgatcgggtggcggggatcctgtccgcctcgggggtctcg
gtggtccccttcgagggggtggagcccaacccgcggctggacacggtccttcggggatct
gaggccgccaggtccgaggggtgtgacgtggtggtggccctggggggaggtagcgttatg
gacgccgccaaggtgatggccgccggggtcttctaccccggggacctgtgggatatgatg
tacgtggggccccggaggccccggttgcccgagcgggccctgcccatcgtgacggtgccc
accttggcggccaccggctccgagatgaacgatggggcggttataacctaccaggacctt
aaggttaaggccttcgtggaggcggagtgcctgttcccccgggtggcggtggtggatccg
gagctgaccctcacggtgccccgaaaccagaccgcctacggggtcagcgacatcatagcc
cacgtgaccgaggcctacttcaacggggtggacggcacccccatccaggactccttcgcc
gagggggtcctgagggccgttgtccagtgggggccagtggcggtggaggaggggggcaac
ctggaggccaggacccaggtccagtgggcctcggtggtggccctgaacggctgggtccag
gtggggacccggggggcctacccggtgcacatgatggagcacaccctgtcggggatccac
gacgtgccccacggggctgggctggcggtgctcaaccccgcctggatgaggttcgccgcc
ccccacaggcccgagcggttcgcccagttcgcccggaacgtcttcggagtccgggaggag
gatcacctcaccgctgccatgaggggaatcgaggccctggaggacctgcttaagcgcatg
ggctgtcccctcaccctgggggagctggggatctcggacccggatccggagctctacgcc
agggccaccctggaggtggcgggggaccgggaggggatgctccggggccgtcccgggatg
tcccgcctcgacctggtggggatattccggtccgtcctgtag

DBGET integrated database retrieval system