KEGG   Thermanaerovibrio acidaminovorans: Taci_1743Help
Entry
Taci_1743         CDS       T01129                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00010  Glycolysis / Gluconeogenesis
tai00030  Pentose phosphate pathway
tai00051  Fructose and mannose metabolism
tai00052  Galactose metabolism
tai00680  Methane metabolism
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01120  Microbial metabolism in diverse environments
tai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Taci_1743
   00030 Pentose phosphate pathway
    Taci_1743
   00051 Fructose and mannose metabolism
    Taci_1743
   00052 Galactose metabolism
    Taci_1743
  Energy metabolism
   00680 Methane metabolism
    Taci_1743
Enzymes [BR:tai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Taci_1743
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Taci_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DUF128 Radical_SAM
Motif
Other DBs
NCBI-GeneID: 8631616
NCBI-ProteinID: YP_003318239
UniProt: D1B7G6
Position
1826456..1827706
Genome map
AA seq 416 aa AA seqDB search
MINRLAILCGGGPAPGINSVISSAAIEAINHGWEVFGLLDGFKPISKGRFEAIRLTIDQV
SRIHTEGGSIIRTSRHNPTVDREDMERAVDTLADAGISHLITIGGDDTAYSALMLSRQSL
AKRAHPIRIAHVPKTIDNDLPLPEGIPTFGFETARSLGAQLLTNIMEDARTTGRWFLCVT
MGRATGHLALGIGKSAGATLILIPEEFGPRVSLGTISDLIVGSVIKRLAMGRGYGVAVVA
EGLMGKIPPEELEELKTADRDEHGHVRYGEVNFSDALRDRVKRTLRELGIKVTLNDKEIG
YELRCAPPNAFDVEYTRNLGYGAFEFLQEGGSGSMVTIQNNRIVPIPLEEIMDPATGRTQ
QRPVNVESIQYRIARRYMIRLTPHDFQDPVALEALCRAARMDREAFVGRFRPLADV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaccgtcttgcgatcctttgcgggggtggtccggcgccggggataaacagcgtg
atcagctccgccgccatcgaggccatcaaccacggctgggaggttttcggcctgctggac
gggttcaagcccatatccaaggggcggtttgaggccattaggctcaccatcgaccaggtg
agccggatccacaccgaggggggcagcatcatccgaacctcccggcacaaccccacggtg
gaccgggaggacatggagcgggcggtggacaccctggcggacgcggggatatcgcacctg
ataaccatcgggggggatgacaccgcctactcggcgctcatgctctcccggcagtccctg
gccaagagggcccatccgatccggatagcccacgtgcccaagaccatcgacaacgacctg
cctctgccggaggggatccccaccttcggtttcgagaccgcccggtccctgggggcccag
ctactgaccaacataatggaggacgcccggaccaccggccggtggttcctgtgcgtcacc
atggggagggccaccggtcacctggcgctggggataggcaagagcgccggggcgaccctg
atcctgatccccgaggagttcggcccccgggtgagcctcggcaccatctcggacctgatc
gtggggtccgtgataaagcggctggccatgggccggggctacggggtggcggtggtggcg
gaggggctcatggggaagatacccccggaggagctggaggagctcaagaccgcagaccgg
gacgagcacgggcacgtgaggtacggggaggttaacttctcggacgctctgagggaccgg
gtcaagaggacgttgcgggagctgggtataaaggttacgctgaacgacaaggagataggc
tacgagctccggtgcgcccctcccaacgccttcgacgtggagtacacccggaacctgggc
tacggggccttcgagttcctccaggaggggggcagcggctccatggtgaccatccagaac
aaccggatagtccccatccccctggaggagataatggaccccgccaccggcaggacccag
cagaggccggtgaacgtggagtccatccagtaccggatagcccgccggtacatgatccgc
cttaccccccatgacttccaggatccggtggccctggaggccctgtgccgggcggcccgt
atggaccgggaggccttcgtgggccggttccgccccctggcggacgtctga

DBGET integrated database retrieval system