KEGG   Thermocrinis albus: Thal_0029Help
Entry
Thal_0029         CDS       T01179                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tal  Thermocrinis albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thal_0029
Enzymes [BR:tal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Thal_0029
Exosome [BR:tal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thal_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(25305..27164)
Genome map
AA seq 619 aa AA seqDB search
MTKVSLITDYDVYLFKEGSHTKLYRKLGAHLVEGGVYFAVWAPNAREVSVIGDFNGWDPH
KHPMRRREDPSGIWETFVPNLPKGTRYKYFLVDAWGNPKEKSDPFAFFWEPPPSTACLVW
DLDYHWNDQVWMATRRSKNSREAPISIYELHVGSWKKGLSYRDLAHELSQYVTEIGFTHV
ELMPVMEHPFYGSWGYQITGYFAPTSRYGTPQDFMYLIDLLHQKGIGVILDWVPSHFPTD
PHGLAFFDGTCLYEYEDWRLRWHPDWNSHVFDYSKGEVRSFLLSSAHFWLDLYHVDGLRV
DAVASMLYLDYSRSEWKPNVYGGRENLEAIEFLKKLNTTVYAQFPDVQTYAEESTAWPMV
SRPVYLGGLGFGFKWNMGWMNDTLFYFSLDPIYRKYHHGILTFNTWYAFSENFVLPLSHD
EVVHGKGSLLQKMWGDVWQKFAHLRLLLAYMYAFPGKKLLFMGNEIAQWEEWNHESSLRW
DLLEYPSHRGIKKLVEDLNRLYREEKALHQLDCEAEGFEWVDFHDWEQSVISFLRKSKEG
EVILCVFNFTPVVRYRYRVGAPAGGTWREILNTDSEIYWGSNVGNMGKVEAQPVVFHSRP
YSLELTLPPLGAIFLKKAF
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtctctctcattaccgactacgatgtttatctctttaaggaagggagtcac
acaaaactctacagaaaactgggcgctcaccttgtggagggaggtgtttactttgccgtt
tgggctcccaacgcgagagaggtctctgtaataggggattttaacggatgggatcctcat
aaacaccccatgaggaggagggaagatccgtcaggtatatgggagacctttgtacccaat
ctcccaaaagggacacgttacaagtactttctcgtagacgcctgggggaaccctaaggag
aagtctgacccctttgccttcttctgggagcctccaccctccaccgcttgcttagtatgg
gatcttgattaccactggaacgatcaggtatggatggccacaaggagatcaaagaacagc
agggaggctcctataagcatatacgaactgcatgtaggttcttggaagaagggtctctct
tacagagatctggctcacgaactttcccagtacgtgacagagatagggtttacccatgtg
gagctgatgcctgttatggagcaccctttttacggatcgtggggttatcagataacaggc
tactttgcgcctacctcacgctacggcacccctcaggactttatgtacctcatagacctt
cttcatcagaagggtataggtgtgatactggactgggtaccatcccactttcccacagat
cctcacggtcttgccttctttgacggtacgtgtctttacgagtacgaagactggcgcctc
aggtggcatcctgactggaacagtcacgtttttgattactctaagggagaggtaagatct
ttccttctcagcagcgcccatttttggctggacctgtatcacgtggacggtctcagagtg
gatgcggtggcctccatgttgtacttggactactcacgctccgagtggaagcctaacgtg
tacggagggagggagaatcttgaagctatagagttcctgaaaaagctcaacactaccgtg
tatgctcagtttcccgatgtacagacctatgccgaggaatccaccgcctggcctatggtg
tcccgtcccgtttacctgggtgggttaggattcggctttaagtggaacatgggatggatg
aacgacaccctcttttacttctcccttgatcccatctacagaaagtaccatcacggtatt
ctcaccttcaacacatggtacgccttttcggagaactttgtgttacccctttctcacgac
gaagtggttcacggtaaaggttctctgcttcaaaagatgtggggtgacgtgtggcaaaag
tttgcccatctaaggttattgctggcttacatgtacgcttttcccggcaaaaagcttctc
tttatgggtaacgagatagcccagtgggaggagtggaaccacgaaagcagccttcgctgg
gatctgttagagtatccaagtcaccgaggtataaaaaagttggtagaagatcttaacaga
ctttacagagaggagaaagctctccaccaactggactgtgaggccgaaggttttgagtgg
gtagacttccatgactgggaacaaagtgtcataagctttctcaggaaatccaaggagggg
gaagtgattctgtgtgtttttaacttcacacctgtggtccgataccgttaccgagtaggt
gctccagcaggaggtacgtggagagagatcctcaacaccgactcagagatatactggggt
agtaacgtggggaatatgggcaaagtggaggcacaacctgtagttttccactcaagaccc
tactctttggagctcactctcccacccttaggagctatcttcctgaagaaggccttttag

DBGET integrated database retrieval system