KEGG   Thermocrinis albus: Thal_0074Help
Entry
Thal_0074         CDS       T01179                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tal  Thermocrinis albus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tal00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(70661..72034)
Genome map
AA seq 457 aa AA seqDB search
MEVKGITHNSKEVYEGYIFVAIEGTNTDGHQFVEEALRRGAIRVYVEKDVGIEDPRIVKV
SDTRKLLGELCHEFYGRPSEKLQVIGVTGTNGKTTTTHILESVFRTAGIKVGLIGTIYYR
LGDKVYRYEGRTTPDPVEWHSTLKAMLEDGAQVVCAEISSHALHQRRVWGTKFFTTIFTN
LSQDHLDYHGDMENYFSAKLLLFTQYPQEFSVINADDPYGKRIVSVVGKRARTYGKEGDL
RITNFETSLEGSRLEVEYEGKRYRFFSHLRGEFQAYNLSAAILTAFLRGIDPQVVEEGVK
DVRVPGRFETYRKDGKTVIVDYAHTPDALEKLLRTARGITRGRLLVVFGAGGNRDRTKRP
LMGEVAQNWADVIVLTSDNPRWEDPISIIEDIMEGISQKNKVLVEPDREKAIRLAVEMAK
EGDVVVIAGKGHEDYQEIKGVRYPFSDSAVVREILHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaagggaataacccacaactctaaagaggtttatgaagggtacatatttgtt
gccatagaggggaccaatacggatggccaccagtttgtagaagaagccctcaggagaggt
gccattagagtgtacgtggaaaaggatgtagggatagaggacccacgcatagtgaaggtt
tccgataccagaaagcttttgggagaactgtgccacgagttttacggaagaccctccgag
aagctgcaggtgataggagttacaggtaccaatggcaagactacgaccacccacatactg
gagtcggtgtttagaacggcgggcattaaggtaggtctcataggaaccatctactacagg
ttgggggataaggtttatcggtacgaaggaagaaccactcccgacccagtagagtggcac
tccaccttgaaagccatgctggaggatggtgctcaggtggtgtgtgcagaaatctcctcc
cacgcgctgcatcaaagaagagtctggggaaccaagttctttaccaccattttcaccaac
ctgtcacaagatcacttggactaccacggtgatatggaaaattacttctctgccaagctc
ctgctgtttacccaatacccccaggagttttctgttataaacgccgatgacccttacgga
aaaaggatagtgtccgttgtgggaaagagagcgaggacatacggtaaggaaggtgacctt
cgcataaccaactttgagacatctctggagggttcccgtctggaggtggagtatgaaggt
aaacgctaccgtttcttctcccacctaaggggtgagtttcaggcctataacctcagcgcc
gccatactaacggccttccttagaggtatagatcctcaggtggtggaagagggggttaag
gatgtgagagtacccggtaggttcgaaacgtaccgtaaggatgggaaaaccgtgatagta
gactacgctcacacgcccgacgctttagagaaacttctcaggaccgccagaggtataaca
agaggcaggctgctggtagtgtttggagctggaggtaacagggatagaaccaaaagaccc
ctcatgggtgaggtggcccagaactgggcagatgtgatcgtactgacctccgataaccct
cgctgggaagatcccataagcatcatagaggatataatggaagggataagccagaagaat
aaggtgctggtagaaccggacagagaaaaggccataaggctggctgtagaaatggcaaag
gaaggtgacgtagtggtgatagcgggtaaaggtcacgaggattatcaggaaataaaggga
gtgaggtatcccttcagcgacagcgcagtggttagggagatactgcatgtgtga

DBGET integrated database retrieval system