KEGG   Thermocrinis albus: Thal_0083Help
Entry
Thal_0083         CDS       T01179                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tal  Thermocrinis albus
Pathway
tal00010  Glycolysis / Gluconeogenesis
tal00052  Galactose metabolism
tal00500  Starch and sucrose metabolism
tal00520  Amino sugar and nucleotide sugar metabolism
tal00521  Streptomycin biosynthesis
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
tal01120  Microbial metabolism in diverse environments
tal01130  Biosynthesis of antibiotics
tal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0083
   00052 Galactose metabolism
    Thal_0083
   00500 Starch and sucrose metabolism
    Thal_0083
   00520 Amino sugar and nucleotide sugar metabolism
    Thal_0083
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thal_0083
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thal_0083
Enzymes [BR:tal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thal_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N TCR NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADC88720
UniProt: D3SNI3
Position
80075..80947
Genome map
AA seq 290 aa AA seqDB search
MALRRIKGVDIGGTFVKVVHHDGRREKFYVHHLVTDREAFLREIKRIVDDGRPEVVGVAV
AGFTSTHGVVDRSPNIPALDGVNLREFLEEDGRKVIVMNDVTAGAYGEWFYHHTDSKVLL
LVAIGTGLGAGLVIDGRPFLGACGSALELGHHILEKDGQQCHCGRRGCWEAYCSSYGLEN
IYRRLTGEHLHHTEIVKVALQGEEKALESVQIMLDYMVTGIMNALHLFNPDRVVLAGGMV
EALKPWLGNLEEEVRKRAEKLPANCFSLHFSSEGEFCMALGALALAQDHI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaggagaataaaaggggtagacataggtgggaccttcgttaaagtggttcat
cacgacggtagaagagagaagttctacgtgcatcacttagtgacagatagagaagccttt
ctacgggagataaagaggatagtggatgacggcagacctgaggtggtgggtgtagctgtg
gcgggttttacatccacccatggtgtagtggacagatctcccaacatacccgctttggac
ggtgtgaacctcagggagtttttagaagaagatgggcgaaaggtgatagtgatgaacgac
gtgacagctggggcttatggcgaatggttctatcatcacaccgacagcaaggttctcctt
ctcgtggctataggaaccggtctgggtgcaggtctcgtgatagatgggaggccctttctt
ggtgcgtgtggcagtgctcttgaactgggtcaccacatactggaaaaggacggacagcag
tgtcactgtggaaggagaggatgttgggaagcttactgttcttcctatggccttgagaac
atctacagaagactcactggggagcatcttcatcacactgagatagtaaaggtggcacta
cagggtgaagaaaaggctctagaaagcgtacagatcatgttggactacatggtaactggt
attatgaacgctcttcacctctttaacccagatagggtggttctggcaggtggtatggtg
gaggccctgaaaccatggctgggtaatctggaagaggaggtaaggaaacgtgccgagaaa
ctacctgctaactgctttagtcttcacttctcttccgagggggagttttgcatggcgttg
ggtgcccttgctctcgcacaggatcatatttga

DBGET integrated database retrieval system