KEGG   Thermocrinis albus: Thal_0083Help
Entry
Thal_0083         CDS       T01179                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0083
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0083
   00052 Galactose metabolism
    Thal_0083
   00500 Starch and sucrose metabolism
    Thal_0083
   00520 Amino sugar and nucleotide sugar metabolism
    Thal_0083
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thal_0083
   00524 Butirosin and neomycin biosynthesis
    Thal_0083
Enzymes [BR:tal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thal_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80075..80947
Genome map
AA seq 290 aa AA seqDB search
MALRRIKGVDIGGTFVKVVHHDGRREKFYVHHLVTDREAFLREIKRIVDDGRPEVVGVAV
AGFTSTHGVVDRSPNIPALDGVNLREFLEEDGRKVIVMNDVTAGAYGEWFYHHTDSKVLL
LVAIGTGLGAGLVIDGRPFLGACGSALELGHHILEKDGQQCHCGRRGCWEAYCSSYGLEN
IYRRLTGEHLHHTEIVKVALQGEEKALESVQIMLDYMVTGIMNALHLFNPDRVVLAGGMV
EALKPWLGNLEEEVRKRAEKLPANCFSLHFSSEGEFCMALGALALAQDHI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaggagaataaaaggggtagacataggtgggaccttcgttaaagtggttcat
cacgacggtagaagagagaagttctacgtgcatcacttagtgacagatagagaagccttt
ctacgggagataaagaggatagtggatgacggcagacctgaggtggtgggtgtagctgtg
gcgggttttacatccacccatggtgtagtggacagatctcccaacatacccgctttggac
ggtgtgaacctcagggagtttttagaagaagatgggcgaaaggtgatagtgatgaacgac
gtgacagctggggcttatggcgaatggttctatcatcacaccgacagcaaggttctcctt
ctcgtggctataggaaccggtctgggtgcaggtctcgtgatagatgggaggccctttctt
ggtgcgtgtggcagtgctcttgaactgggtcaccacatactggaaaaggacggacagcag
tgtcactgtggaaggagaggatgttgggaagcttactgttcttcctatggccttgagaac
atctacagaagactcactggggagcatcttcatcacactgagatagtaaaggtggcacta
cagggtgaagaaaaggctctagaaagcgtacagatcatgttggactacatggtaactggt
attatgaacgctcttcacctctttaacccagatagggtggttctggcaggtggtatggtg
gaggccctgaaaccatggctgggtaatctggaagaggaggtaaggaaacgtgccgagaaa
ctacctgctaactgctttagtcttcacttctcttccgagggggagttttgcatggcgttg
ggtgcccttgctctcgcacaggatcatatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system