KEGG   Thermocrinis albus: Thal_0167Help
Entry
Thal_0167         CDS       T01179                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tal  Thermocrinis albus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tal01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tal00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tal00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(155836..157032)
Genome map
AA seq 398 aa AA seqDB search
MKKLPDERGYFGEFGGRFVPETLMYALEQLEEAYTKVKEDPTFWQELENYLHHYAGRPTP
LYLAENLTRYAGGAKIYIKREDLLHTGAHKINNTLGQVLLTKRMGKKRVIAETGAGQHGV
ATATACALMGLECVIYMGEEDAQRQRLNLFRMELLGAKVHIVRSGSRTLKDAINEALRDW
VTNVDTTHYVIGSVVGPHPFPMMVRDFQSVIGKEVKEQILRAEGRLPDAVVACVGGGSNA
MGIFYPFVEHPEVKLIGVEAGGMGLHTGQHAASINGGSVGVLHGMKSYFLQDEEGQILPT
HSVSAGLDYPGVGPEHAYLFQSGRAIYLTATDEEALEGFKLLARLEGIIPALEPAHAVLK
TVEIAREIGKGGIVVLNLSGRGDKDIQHVIELLHGSAT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttcccgatgagagaggatacttcggtgagtttggtggaaggtttgttcca
gaaaccctcatgtacgctctggagcagctggaagaagcctacacaaaggtaaaagaagat
cccaccttctggcaggagctggaaaactaccttcatcactacgcaggaagacctacaccc
ctttacttggctgagaatctaacccgttacgcaggtggtgccaagatctacataaagaga
gaggatcttctccacacgggagcccacaaaatcaacaacaccttaggtcaggtactcctc
accaaaaggatgggtaagaaaagggtcatagcggagacaggtgcgggacaacacggtgtt
gccaccgctacagcctgtgcccttatgggtcttgagtgtgtcatctacatgggcgaggag
gacgctcagagacagagacttaacctcttcagaatggagcttttgggtgccaaggtacac
atagtgaggagtggtagcaggaccctcaaggacgctataaacgaagctctcagagactgg
gtcaccaacgtggataccacccactacgtgataggatccgtggtgggtcctcatcccttt
cccatgatggtgagagattttcagagtgtgataggtaaagaagtaaaggagcagatctta
cgtgcggaaggaaggcttcccgatgctgtggtggcctgtgtgggtggtggctccaacgct
atgggtatcttttaccccttcgtagaacatccggaagtcaaactgataggtgtagaagca
ggtggtatgggtctccatacgggccaacatgcagcatctataaacggtggctccgtgggt
gttcttcatggtatgaaatcttacttcctgcaggacgaggaaggccagatactacccacc
cattccgtgtcggcgggactagactatcccggagtagggccagaacacgcctaccttttt
caatcaggtagggccatatacctcacagccactgatgaggaagcactggagggctttaag
cttctggccagactggagggtataatacccgctcttgagcctgctcacgccgttctgaaa
acagtagagatagcaagggagatagggaaaggtggcatcgtggttctaaacctctccggg
agaggtgataaggacatacagcacgttatcgagcttttgcatggctcagctacctag

DBGET integrated database retrieval system