KEGG   Thermocrinis albus: Thal_0203Help
Entry
Thal_0203         CDS       T01179                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tal  Thermocrinis albus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(191988..192491)
Genome map
AA seq 167 aa AA seqDB search
MVRFVFFLFLIASFVQGEDIEKEFLKEQIKSVPLNKAVIVGKGKERVLVFMNPDCPHCRK
EWQELKGCLHKLRLYVFLVPFPRFPESYQKSAYVVCSKNHLRALDEVLSGKWDQRPLPVK
SCPLLKEHERIAKEMGVSAVPYNILLRDYTVVSGYSPDLRKKLSCDR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttttgtcttcttcctctttctcatcgcctcctttgtgcagggagaggatata
gagaaggagtttctaaaggagcagatcaagagtgttcctttaaacaaagcggtgatagtt
ggcaaaggaaaagagagagttttggtttttatgaaccctgactgccctcactgtagaaaa
gaatggcaggaactgaagggttgtcttcataaactgcgcctttacgtgtttttggtacct
tttcccagatttcccgaaagctatcaaaagtccgcctatgtggtctgttctaagaatcat
ctaagagccctcgacgaggttctttcgggaaaatgggatcaaaggcctctacctgtaaag
tcatgtcctcttctcaaagagcacgaaaggatagctaaggaaatgggtgtgtctgcagtc
ccctataatatcctcctaagagattatacggtggtcagtggttactcacctgaccttaga
aaaaagttatcgtgtgacaggtaa

DBGET integrated database retrieval system