KEGG   Thermocrinis albus: Thal_0282Help
Entry
Thal_0282         CDS       T01179                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tal  Thermocrinis albus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thal_0282
Enzymes [BR:tal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Thal_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283036..283593
Genome map
AA seq 185 aa AA seqDB search
MGIDREKIKQAVRLFLEGIGEDPDREGLKETPDRIARMWEEFERQREFNFKLFEEFGQYN
EMVVVKDITIYSFCEHHLLPFFGKAHVAYVPDRVVCGLSKLVRTVKAFALRPQVQERLTA
QIADFLMEQLKPKGVAVVLECEHLCMSMRGVMSPGHITTTSALRGIFLSDIRTREEFLKL
IGKKL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggtatagatagggaaaagatcaagcaagctgtacgcctctttctggaaggtatagga
gaagatcctgaccgagagggactgaaggagacacctgaccgcatagcacgtatgtgggag
gagtttgaaagacagagagagttcaactttaagctttttgaggagtttggccagtacaac
gagatggtagtggtaaaagacataaccatatacagcttttgcgaacatcacctccttccc
ttctttgggaaagctcacgtggcttacgtacctgatagggtggtgtgtggactttctaaa
ttggtgaggacagttaaggcctttgccctaagaccccaggtccaggagaggctgacagct
cagatagctgactttctgatggaacagctaaagcccaaaggtgtggctgtggttttagaa
tgtgaacacctgtgtatgtccatgaggggtgtaatgtcaccaggacatataaccaccacc
tccgccctcaggggtatattcctgtccgatatcagaacaagggaggagtttcttaagctg
ataggcaagaagctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system