KEGG   Thermocrinis albus: Thal_0399Help
Entry
Thal_0399         CDS       T01179                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thal_0399
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0399
  Lipid metabolism
   00071 Fatty acid degradation
    Thal_0399
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thal_0399
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thal_0399
   00626 Naphthalene degradation
    Thal_0399
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thal_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395423..396577
Genome map
AA seq 384 aa AA seqDB search
MKFEFYLPVEVIFGVGSLNRLGEVARRFGFKAILVTGRQSARKSGALEKAIDSLKRHGIK
EVLVFDEVEPNPTDTTVNQLSRLIVEEKVDFIVGLGGGSALDVAKASSLVSSNEGSAWDY
VNYPEGPRLIPFLNRPVICVPTTAGTGSEVNRYSVISSPVRKEKMVISHSLNYPKAAIVD
PELTVSMSRKLTAVTGVDAFMHALEAFTNRVEDTFADHLAITALSIIKEWLPIALEEPEN
LKARAQMSYAATLAGIAIDRKRVALIHGMEHPVSAHYPHVAHGEGLAALAPAVTEFNYRG
NPEKYKVVAEVLGCGSEPHRAVDCVVRFLEKVGLLITLKDLGVEKEKLERLAEDVYLLAR
GLFLINPVEPSIEDIYKLYEKAYG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgagttttatttgccggtagaagttatctttggagttggatctctcaaccga
ctgggtgaggtagccaggcgttttggtttcaaggccattttggtgacaggaaggcagagt
gcccgcaagagcggtgctttggaaaaagcgatagattctctgaaaagacatggcataaag
gaagttttggtttttgatgaggtagagcccaatccaaccgataccaccgttaaccaactg
agcaggttgattgtggaagaaaaggtggactttatagtgggattggggggaggtagtgcc
ttggatgttgccaaggcatcttccttagtttcctctaacgaaggctctgcgtgggactac
gtcaattacccagagggtccaagacttatcccttttctaaacagacctgtcatatgtgta
cccaccacagcaggtacaggtagcgaagtgaaccgttactctgtcatatcgagtcccgtc
agaaaggagaagatggtaatatcccactctctcaactaccctaaggcggccatagtggat
cctgaactgactgtcagcatgagcagaaagctcaccgctgtaactggtgttgatgccttt
atgcacgccttggaagccttcaccaaccgcgtggaagatacctttgctgatcacttagcc
atcacagctttatccatcataaaagaatggttgcctatagctctggaagagccggagaat
cttaaagcgagagcccagatgagttatgctgccacactggcgggaatagcgatagacaga
aagagggtcgccctcatacacgggatggagcatcctgtttctgctcactatcctcatgta
gctcacggagagggacttgctgcgcttgcacctgcggttaccgaattcaactacagaggt
aacccggaaaagtacaaggtagtggctgaagttctcggatgtgggtctgaaccgcacaga
gctgtggactgcgtggtaaggttcttagaaaaagtgggtcttctgattaccctgaaagac
ctaggtgtagaaaaggagaaattagaaagacttgctgaggacgtttacttactggcaagg
ggtctgtttttgataaacccggtggaaccttccatagaagatatctacaaactctacgaa
aaggcctacggctga

DBGET integrated database retrieval system