KEGG   Thermocrinis albus: Thal_0547Help
Entry
Thal_0547         CDS       T01179                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tal  Thermocrinis albus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thal_0547
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0547
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thal_0547
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thal_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523820..525052
Genome map
AA seq 410 aa AA seqDB search
MAKVKGLRCRECGREYPAEPIHVCEFCFGPLEVEYDYDLIRNTVSREKIERGPKSLWRYV
DLLPVEEPKVGLTAGFTPLRKAENLGKVLGLKELYIKDDSVNHPTLSFKDRVVSVALSKA
VEFGFDTAACASTGNLANSVAAHSAQAGLNCYVFIPANLETQKIYGSLVYSPTVVAVEGN
YDDVNRLCSEIANELNWAFVNINIRPYYAEGSKTLAFEVAEQLGWRAPDAVVAPAASGSL
VTKIWKGFKELRMVGLIDGKLPRVYGAQAEGCSPIAQAWKEGRDYIKPVKPNTIAKSIAI
GNPADGIYALAVTRESGGEWETATDEEIIEGIKLLAETEGIFTETAGGTTVAVLKKLAQR
GVFRPDEVVVVYITGNGYKTMEVLEGHLKDVVRIKPTLADFRDKILVRVP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtgaaggggctcaggtgcagagagtgtggaagagagtaccctgcagagccc
atccacgtgtgtgagttctgcttcggcccgctggaggtggagtacgattacgatcttata
aggaatactgtaagtagggagaagatagagagaggtcccaagagtctgtggagatacgta
gatctacttcccgtagaggagcctaaggtaggacttacagccggtttcactccccttagg
aaagcggagaatctgggtaaagtgttgggtcttaaggagctttacataaaagacgactcg
gtgaaccaccccaccctctccttcaaagaccgagtagtttcggtagctctctccaaagcg
gtggagttcggatttgacactgccgcttgcgcttccacaggtaatctggccaactcggtg
gctgcccacagtgcacaagccggacttaactgttacgttttcatacctgccaatctggaa
acccagaagatatacggtagccttgtctacagccccacggtggtggcggtggaaggtaac
tacgacgatgtcaacagactatgctctgagatagccaacgaacttaactgggcttttgtt
aacatcaacataagaccctactatgcggaaggttctaaaaccctagcctttgaggtggct
gaacagttaggttggcgtgcacccgatgcggtagtggctcccgctgcctctggttcctta
gtcaccaagatatggaaaggatttaaagagctgcgcatggtgggtctaatagacggaaaa
cttccccgtgtctacggcgctcaagcggagggatgttcccccatagctcaagcgtggaag
gaggggagagactacataaaacctgtaaaacccaacactatagccaagtccatagctata
ggcaacccagctgatggtatatatgctctcgccgttaccagagagagcggtggagagtgg
gaaacagctaccgacgaagagatcatagagggtatcaagctccttgctgaaacagaagga
atatttacagaaacggcaggtggtaccaccgtagctgttctcaagaaactggctcaaaga
ggtgtttttagacccgacgaagtggtggtggtttacataacaggcaacgggtacaaaaca
atggaagttctggaagggcatctgaaggatgtggttaggataaaacccactttggcagat
ttcagggacaagatactggtgagggttccttga

DBGET integrated database retrieval system