KEGG   Thermocrinis albus: Thal_0547Help
Entry
Thal_0547         CDS       T01179                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tal  Thermocrinis albus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thal_0547
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0547
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thal_0547
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thal_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523820..525052
Genome map
AA seq 410 aa AA seqDB search
MAKVKGLRCRECGREYPAEPIHVCEFCFGPLEVEYDYDLIRNTVSREKIERGPKSLWRYV
DLLPVEEPKVGLTAGFTPLRKAENLGKVLGLKELYIKDDSVNHPTLSFKDRVVSVALSKA
VEFGFDTAACASTGNLANSVAAHSAQAGLNCYVFIPANLETQKIYGSLVYSPTVVAVEGN
YDDVNRLCSEIANELNWAFVNINIRPYYAEGSKTLAFEVAEQLGWRAPDAVVAPAASGSL
VTKIWKGFKELRMVGLIDGKLPRVYGAQAEGCSPIAQAWKEGRDYIKPVKPNTIAKSIAI
GNPADGIYALAVTRESGGEWETATDEEIIEGIKLLAETEGIFTETAGGTTVAVLKKLAQR
GVFRPDEVVVVYITGNGYKTMEVLEGHLKDVVRIKPTLADFRDKILVRVP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtgaaggggctcaggtgcagagagtgtggaagagagtaccctgcagagccc
atccacgtgtgtgagttctgcttcggcccgctggaggtggagtacgattacgatcttata
aggaatactgtaagtagggagaagatagagagaggtcccaagagtctgtggagatacgta
gatctacttcccgtagaggagcctaaggtaggacttacagccggtttcactccccttagg
aaagcggagaatctgggtaaagtgttgggtcttaaggagctttacataaaagacgactcg
gtgaaccaccccaccctctccttcaaagaccgagtagtttcggtagctctctccaaagcg
gtggagttcggatttgacactgccgcttgcgcttccacaggtaatctggccaactcggtg
gctgcccacagtgcacaagccggacttaactgttacgttttcatacctgccaatctggaa
acccagaagatatacggtagccttgtctacagccccacggtggtggcggtggaaggtaac
tacgacgatgtcaacagactatgctctgagatagccaacgaacttaactgggcttttgtt
aacatcaacataagaccctactatgcggaaggttctaaaaccctagcctttgaggtggct
gaacagttaggttggcgtgcacccgatgcggtagtggctcccgctgcctctggttcctta
gtcaccaagatatggaaaggatttaaagagctgcgcatggtgggtctaatagacggaaaa
cttccccgtgtctacggcgctcaagcggagggatgttcccccatagctcaagcgtggaag
gaggggagagactacataaaacctgtaaaacccaacactatagccaagtccatagctata
ggcaacccagctgatggtatatatgctctcgccgttaccagagagagcggtggagagtgg
gaaacagctaccgacgaagagatcatagagggtatcaagctccttgctgaaacagaagga
atatttacagaaacggcaggtggtaccaccgtagctgttctcaagaaactggctcaaaga
ggtgtttttagacccgacgaagtggtggtggtttacataacaggcaacgggtacaaaaca
atggaagttctggaagggcatctgaaggatgtggttaggataaaacccactttggcagat
ttcagggacaagatactggtgagggttccttga

DBGET integrated database retrieval system