KEGG   Thermocrinis albus: Thal_0714Help
Entry
Thal_0714         CDS       T01179                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tal  Thermocrinis albus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thal_0714
Enzymes [BR:tal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Thal_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(681913..683007)
Genome map
AA seq 364 aa AA seqDB search
MPGKGRMFYGERFEDVNEPIFTGIPTFLKLPYVPSIEELAKLKPDIAIIGEPMDMATTIR
PGARYGPRAVRAASTVPSPPYSHFNIETGVDPFDEFFVVDHGDARVVPGDTMATLKNFER
KVYEVSSLGICPFIIGGDHSVTFANIKGWAEARGYKKIGLIHFDCHADTAHTGLCGFEYD
HGAHIRRIWDLGILNGENYTLIGPRGFWPDKKTYEWMRDNGMLWFTSFDVWEIGIKKIAE
IAVERALDGTDAVWLTFDVDVMDPSVCPGTGEPEPGGLTPREAIGLIRLITKHFDVERFG
FDILEVAPMYDVSDNSSYNGGITSLFASRIILEVMGGLAIKRAGWSEGRPVRPKTETRSQ
SQNI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtaaaggtaggatgttttatggagagcgttttgaagatgtaaatgagccaata
tttacaggaatacctacttttctaaaattaccttatgtgccatctatcgaagaattggct
aagctaaaaccagatattgcaataatcggagaacctatggatatggctacgactataaga
ccgggagctagatatggccctagggctgtaagagctgcatctacagtcccctctccacca
tattctcactttaatatcgaaacaggtgtagatccttttgatgagttttttgtagttgat
cacggagatgctcgtgttgttcccggagataccatggctacactaaaaaacttcgagagg
aaagtttatgaagtctcgagtctaggcatatgtccattcataattggaggcgatcactct
gtaacattcgctaacataaaaggttgggcagaggctaggggttataaaaaaatagggctt
attcattttgattgtcatgcagatacagcacatactggactatgtggatttgaatacgat
cacggcgcacatataagaagaatttgggatcttggaatactaaatggcgaaaattataca
cttataggaccacgtggtttttggccagataaaaaaacatatgaatggatgagagacaac
ggtatgctctggttcacatcttttgatgtatgggagataggtataaagaaaatagctgaa
atagctgtagaaagggcattagatggaactgatgctgtatggttaactttcgatgttgat
gtcatggacccaagtgtttgtcctggaacgggagaaccagagcctggtggtttaactcca
agagaagcaatagggcttattagactgattactaagcactttgatgtagaaagatttggt
tttgatatccttgaagttgccccgatgtatgatgtaagcgataacagttcatataatggt
ggtataacctccctgttcgcaagtagaattattcttgaagtaatggggggacttgccata
aaacgtgcaggatggtccgaaggcagacctgtaagacctaaaacagaaactagaagtcaa
agccaaaacatatga

DBGET integrated database retrieval system