KEGG   Thermocrinis albus: Thal_0782Help
Entry
Thal_0782         CDS       T01179                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0782
   00620 Pyruvate metabolism
    Thal_0782
   00640 Propanoate metabolism
    Thal_0782
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_0782
   00680 Methane metabolism
    Thal_0782
Enzymes [BR:tal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thal_0782
Lipid biosynthesis proteins [BR:tal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thal_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740272..742164
Genome map
AA seq 630 aa AA seqDB search
MAERDEVLLKVQEKYYPPAHIVERAWVKDYESLYAQSVQDREGFWAKVAEELHWFRKWDK
VLDWQFPYAQWFVGAKTNISYNCLDRHVLQGRRNKVAYIWVDEDNNERKITYGELLELVS
RIANGLKSLGVKKGDRVSIYMPNSIEAVACMLACARIGAIHSVVFAGFSEGALRLRIEDA
KAKVVITASYTKRRGKKIDLLATVNRAIDGLSFVEKVIVWDRDGDALNGESSLFVSFDSL
VKGASPHCEPEVMDAEDPLFILYTSGTTGKPKGVLHTTGGYMVGTYYTTKVVFDLHEDDV
YWCTADIGWITGHSYIVYGPLANGATSIIVEGAPDYPDPGRWWSYVEKYRVNIFYTAPTA
IRMFMRYGEQWPAQYDLSSLRVLGSVGEPINPEAWHWYYKHIGRERCVIVDTWWQTETGA
HMITTVPSYPAKPGKAGKPFFTIEAAVVDSSGKELPPNTVGNLVIKSPWPSMLRTCWGEP
ERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADDVLNVAGHRIGTMEVESALVDHPAV
AEAAVIGKPHEIKGESIKAFVILKKGYEPSEKLVEEIKQHVRNVLGAIAVPDEIEFVEKL
PKTRSGKIMRRVLKAQELGLPVGDISTLED
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagagatgaagttcttcttaaggtgcaagagaagtactatccgccggcccac
atagtggagagggcttgggtgaaagattacgaaagtctctacgctcagtcggtacaagac
agggaaggtttctgggccaaggtggcggaagaactccattggttcagaaagtgggacaaa
gtactagactggcagtttccttacgctcagtggttcgtaggagcaaagaccaacataagc
tacaactgtcttgatagacatgtccttcaggggagaagaaacaaggtagcttacatatgg
gtggacgaagacaacaacgaaaggaagatcacatacggagagcttttagaacttgtcagc
aggatagccaacggtcttaagtccttaggtgtaaagaaaggagacagagtttccatatac
atgcccaacagcatagaggctgtggcatgtatgctggcatgtgccagaataggtgctatc
cacagtgtggtgtttgccggtttcagtgaaggagcgttacgcctcaggatagaagatgcc
aaagccaaggtggtgataacggcatcctacaccaaaaggaggggtaagaagatagatcta
ctggccaccgtcaatagagctatagacggtctttcctttgtggagaaggtgatagtctgg
gacagagatggtgatgctctcaacggcgaaagctccctctttgtaagctttgacagcttg
gtaaagggagcctctccccattgtgaaccggaggtaatggatgcagaggatcccctcttt
atcctctacacttctggaactacaggaaagcccaaaggtgtccttcacaccacagggggc
tacatggtgggtacctactacaccaccaaggtggtttttgatcttcacgaagatgacgta
tactggtgtaccgccgacataggctggataacgggccactcttacatcgtttacggtccc
ttagctaacggtgccacatccatcatagtggaaggtgcacccgactatcccgatccagga
agatggtggagttacgtggaaaagtaccgcgtcaacatcttttacacagcacctaccgcc
ataaggatgtttatgagatacggtgagcagtggcctgcccagtatgatctctcttccctc
agagtgcttggttctgtgggagaacccataaaccctgaggcatggcactggtactacaaa
catataggaagagagagatgcgtgatcgtggacacttggtggcagacggaaacaggtgct
cacatgataaccacagtcccatcttatcctgcaaagcccggcaaggcaggtaaacctttc
tttaccatagaagccgcggtggtggacagctccggaaaggaacttcctcccaacacggtg
ggtaacttggtgataaaaagtccctggccttccatgttaagaacctgctggggtgaaccg
gaaagatacgaaaagtactggaacaccataccgggctactacctgacgggtgacctcgcc
tcttatgacgaagaaggctacataatgatactgggaagggctgatgacgttctgaacgtg
gcagggcacaggatcggaaccatggaggtggagagcgcactggtggaccatcctgccgtg
gcagaggctgcagttatcggaaagcctcacgaaattaaaggagaatccataaaagccttt
gtgattctcaaaaagggctacgaaccttcggaaaagctcgttgaggagatcaaacagcac
gtgaggaacgtgctaggtgccatagcggttcccgacgaaatagagtttgtggagaaactt
ccaaaaacaagaagtggaaagatcatgagaagggtactcaaggctcaggagttgggtctc
cctgtgggagacatatccactctggaagactaa

DBGET integrated database retrieval system