KEGG   Thermocrinis albus: Thal_0782Help
Entry
Thal_0782         CDS       T01179                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0782
   00620 Pyruvate metabolism
    Thal_0782
   00640 Propanoate metabolism
    Thal_0782
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_0782
   00680 Methane metabolism
    Thal_0782
Enzymes [BR:tal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thal_0782
Lipid biosynthesis proteins [BR:tal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thal_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740272..742164
Genome map
AA seq 630 aa AA seqDB search
MAERDEVLLKVQEKYYPPAHIVERAWVKDYESLYAQSVQDREGFWAKVAEELHWFRKWDK
VLDWQFPYAQWFVGAKTNISYNCLDRHVLQGRRNKVAYIWVDEDNNERKITYGELLELVS
RIANGLKSLGVKKGDRVSIYMPNSIEAVACMLACARIGAIHSVVFAGFSEGALRLRIEDA
KAKVVITASYTKRRGKKIDLLATVNRAIDGLSFVEKVIVWDRDGDALNGESSLFVSFDSL
VKGASPHCEPEVMDAEDPLFILYTSGTTGKPKGVLHTTGGYMVGTYYTTKVVFDLHEDDV
YWCTADIGWITGHSYIVYGPLANGATSIIVEGAPDYPDPGRWWSYVEKYRVNIFYTAPTA
IRMFMRYGEQWPAQYDLSSLRVLGSVGEPINPEAWHWYYKHIGRERCVIVDTWWQTETGA
HMITTVPSYPAKPGKAGKPFFTIEAAVVDSSGKELPPNTVGNLVIKSPWPSMLRTCWGEP
ERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADDVLNVAGHRIGTMEVESALVDHPAV
AEAAVIGKPHEIKGESIKAFVILKKGYEPSEKLVEEIKQHVRNVLGAIAVPDEIEFVEKL
PKTRSGKIMRRVLKAQELGLPVGDISTLED
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagagatgaagttcttcttaaggtgcaagagaagtactatccgccggcccac
atagtggagagggcttgggtgaaagattacgaaagtctctacgctcagtcggtacaagac
agggaaggtttctgggccaaggtggcggaagaactccattggttcagaaagtgggacaaa
gtactagactggcagtttccttacgctcagtggttcgtaggagcaaagaccaacataagc
tacaactgtcttgatagacatgtccttcaggggagaagaaacaaggtagcttacatatgg
gtggacgaagacaacaacgaaaggaagatcacatacggagagcttttagaacttgtcagc
aggatagccaacggtcttaagtccttaggtgtaaagaaaggagacagagtttccatatac
atgcccaacagcatagaggctgtggcatgtatgctggcatgtgccagaataggtgctatc
cacagtgtggtgtttgccggtttcagtgaaggagcgttacgcctcaggatagaagatgcc
aaagccaaggtggtgataacggcatcctacaccaaaaggaggggtaagaagatagatcta
ctggccaccgtcaatagagctatagacggtctttcctttgtggagaaggtgatagtctgg
gacagagatggtgatgctctcaacggcgaaagctccctctttgtaagctttgacagcttg
gtaaagggagcctctccccattgtgaaccggaggtaatggatgcagaggatcccctcttt
atcctctacacttctggaactacaggaaagcccaaaggtgtccttcacaccacagggggc
tacatggtgggtacctactacaccaccaaggtggtttttgatcttcacgaagatgacgta
tactggtgtaccgccgacataggctggataacgggccactcttacatcgtttacggtccc
ttagctaacggtgccacatccatcatagtggaaggtgcacccgactatcccgatccagga
agatggtggagttacgtggaaaagtaccgcgtcaacatcttttacacagcacctaccgcc
ataaggatgtttatgagatacggtgagcagtggcctgcccagtatgatctctcttccctc
agagtgcttggttctgtgggagaacccataaaccctgaggcatggcactggtactacaaa
catataggaagagagagatgcgtgatcgtggacacttggtggcagacggaaacaggtgct
cacatgataaccacagtcccatcttatcctgcaaagcccggcaaggcaggtaaacctttc
tttaccatagaagccgcggtggtggacagctccggaaaggaacttcctcccaacacggtg
ggtaacttggtgataaaaagtccctggccttccatgttaagaacctgctggggtgaaccg
gaaagatacgaaaagtactggaacaccataccgggctactacctgacgggtgacctcgcc
tcttatgacgaagaaggctacataatgatactgggaagggctgatgacgttctgaacgtg
gcagggcacaggatcggaaccatggaggtggagagcgcactggtggaccatcctgccgtg
gcagaggctgcagttatcggaaagcctcacgaaattaaaggagaatccataaaagccttt
gtgattctcaaaaagggctacgaaccttcggaaaagctcgttgaggagatcaaacagcac
gtgaggaacgtgctaggtgccatagcggttcccgacgaaatagagtttgtggagaaactt
ccaaaaacaagaagtggaaagatcatgagaagggtactcaaggctcaggagttgggtctc
cctgtgggagacatatccactctggaagactaa

DBGET integrated database retrieval system