KEGG   Thermocrinis albus: Thal_0791Help
Entry
Thal_0791         CDS       T01179                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0791
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0791
   00020 Citrate cycle (TCA cycle)
    Thal_0791
   00620 Pyruvate metabolism
    Thal_0791
   00640 Propanoate metabolism
    Thal_0791
   00650 Butanoate metabolism
    Thal_0791
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_0791
   00680 Methane metabolism
    Thal_0791
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thal_0791
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thal_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(750078..750791)
Genome map
AA seq 237 aa AA seqDB search
MMRKRLNIRMPALGGQGAVTAAHIIATAADYEGYYAVSNPFFGAEKRMAPAESYARIGVE
PIFDRGEVVYPDIIMVFHPQVITMGKSYTMPFYSGIKKNGLIIINSDEDLLTDEDKERLQ
ALDVKVLNFNATKFAIDIAGTELATNMAMIGALFGAIGVVGLEAIEEGIKSRFLKKFVAS
GGTASLDSALERKFKKKLELIEKNLNTAKAAYELARRWAQEQGLEPFLPPPPKKVLV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggaagcgtctcaacatacgtatgccagctttgggtggacagggagcggttacc
gcagcccatataatagccacggctgctgattacgaaggttactacgccgtttcaaaccct
ttctttggtgctgagaaaagaatggcacctgccgaaagttatgcccgtataggggttgag
cctatctttgacagaggtgaggtggtgtatcccgacatcataatggtgttccaccctcag
gtcatcactatgggcaagtcttacaccatgcctttctactcaggaataaagaagaacggt
cttattatcataaactccgacgaggatctactcactgacgaagataaggagagactgcag
gccttagatgtcaaggtgctgaactttaacgccaccaagtttgcgatagacatagcgggg
acagagctggctaccaacatggccatgataggtgccctctttggagccataggagttgtt
ggactggaggctatagaggagggtataaagtccagattcctcaagaagtttgtagcatca
ggtggtacagcttctctggactcagcgctggagaggaagtttaaaaagaaactggagctt
atagagaagaaccttaacaccgccaaagctgcttacgaactagccagaaggtgggctcaa
gagcaaggtcttgagccattcctcccaccacctcccaaaaaagtcctcgtttga

DBGET integrated database retrieval system