KEGG   Thermocrinis albus: Thal_0824Help
Entry
Thal_0824         CDS       T01179                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0824
   01230 Biosynthesis of amino acids
    Thal_0824
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0824
   00051 Fructose and mannose metabolism
    Thal_0824
   00562 Inositol phosphate metabolism
    Thal_0824
Enzymes [BR:tal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thal_0824
Exosome [BR:tal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thal_0824
  Exosomal proteins of bladder cancer cells
   Thal_0824
  Exosomal proteins of melanoma cells
   Thal_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782006..782752
Genome map
AA seq 248 aa AA seqDB search
MKLIAANWKMNKTQREAEEYVSKFLPLVKDVTKTEILLCPPFTSLCKVSQMLEGSNVKLG
AQNCHSEKKGAFTGEISTVMLKDLGVEYVIVGHSERRWIFGESDEIIHKKIVACLEEGLR
PILCVGERWEDREAGMTFKVIETQIKLALSGLDAFVSKIDIAYEPVWAIGTGNPATPEDA
QLVHRFIKDLVGPVRVLYGGSVNTSNAGDFLRMPDVDGLLVGTASLDPESFFQIIQASEN
HHQQEEGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatagctgccaactggaagatgaacaaaacacaacgggaggcggaggagtac
gtaagtaagttcttacctttggtgaaagatgtcaccaaaacagagatactcctctgccct
cccttcacatctctctgtaaagtctctcaaatgctggaaggatctaacgtaaaactgggt
gctcagaactgccattccgaaaaaaagggagcctttacgggagagatatctaccgtcatg
ctcaaggatctaggtgtggagtacgtaatagtggggcattccgaaaggcgttggatcttt
ggtgagtctgatgaaattatccacaagaaaatcgtggcctgtttggaggagggtctcaga
cctattctctgtgtaggtgaaaggtgggaggacagagaggcagggatgacctttaaagtt
atagagacgcagataaaactggctctaagcgggttggatgcttttgtttctaaaatagac
atagcttacgaacctgtctgggctatcggtacaggtaaccccgctacaccggaggatgcc
cagctggttcacagattcataaaggatctggtgggacctgtgagagtactgtacggtggt
agcgtgaacacttccaacgcaggtgattttctgaggatgccggacgtagatggtcttttg
gtgggtacagccagtttagaccccgaatcctttttccagatcatacaggcttctgagaac
catcatcaacaggaagaaggagggtaa

DBGET integrated database retrieval system