KEGG   Thermocrinis albus: Thal_0824Help
Entry
Thal_0824         CDS       T01179                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0824
   01230 Biosynthesis of amino acids
    Thal_0824
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0824
   00051 Fructose and mannose metabolism
    Thal_0824
   00562 Inositol phosphate metabolism
    Thal_0824
Enzymes [BR:tal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thal_0824
Exosome [BR:tal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thal_0824
  Exosomal proteins of bladder cancer cells
   Thal_0824
  Exosomal proteins of melanoma cells
   Thal_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782006..782752
Genome map
AA seq 248 aa AA seqDB search
MKLIAANWKMNKTQREAEEYVSKFLPLVKDVTKTEILLCPPFTSLCKVSQMLEGSNVKLG
AQNCHSEKKGAFTGEISTVMLKDLGVEYVIVGHSERRWIFGESDEIIHKKIVACLEEGLR
PILCVGERWEDREAGMTFKVIETQIKLALSGLDAFVSKIDIAYEPVWAIGTGNPATPEDA
QLVHRFIKDLVGPVRVLYGGSVNTSNAGDFLRMPDVDGLLVGTASLDPESFFQIIQASEN
HHQQEEGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatagctgccaactggaagatgaacaaaacacaacgggaggcggaggagtac
gtaagtaagttcttacctttggtgaaagatgtcaccaaaacagagatactcctctgccct
cccttcacatctctctgtaaagtctctcaaatgctggaaggatctaacgtaaaactgggt
gctcagaactgccattccgaaaaaaagggagcctttacgggagagatatctaccgtcatg
ctcaaggatctaggtgtggagtacgtaatagtggggcattccgaaaggcgttggatcttt
ggtgagtctgatgaaattatccacaagaaaatcgtggcctgtttggaggagggtctcaga
cctattctctgtgtaggtgaaaggtgggaggacagagaggcagggatgacctttaaagtt
atagagacgcagataaaactggctctaagcgggttggatgcttttgtttctaaaatagac
atagcttacgaacctgtctgggctatcggtacaggtaaccccgctacaccggaggatgcc
cagctggttcacagattcataaaggatctggtgggacctgtgagagtactgtacggtggt
agcgtgaacacttccaacgcaggtgattttctgaggatgccggacgtagatggtcttttg
gtgggtacagccagtttagaccccgaatcctttttccagatcatacaggcttctgagaac
catcatcaacaggaagaaggagggtaa

DBGET integrated database retrieval system