KEGG   Thermocrinis albus: Thal_0879Help
Entry
Thal_0879         CDS       T01179                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0879
   01230 Biosynthesis of amino acids
    Thal_0879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0879
  Energy metabolism
   00680 Methane metabolism
    Thal_0879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0879
Enzymes [BR:tal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Thal_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830893..831528)
Genome map
AA seq 211 aa AA seqDB search
MVKLFVVRHAESTWNPEGRYQGLLDPELSQRGLQQARLLAEALRNVPFDVIYSSPLRRTY
LTALEIAKGRDVHVVKDERIREIDHGVWSGLTVEEVKRRFPETFRMWMEEPHRTSFEGGE
SLTDVYRRVADFVEEIKRKHQHQTVAVVSHTVPIRAMYCYLLGVDLSRFWSFGCDNASYS
VIHLEENRNVIQKLNITCHLGEYYVEAHSAL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctttgtggtgcgtcacgccgaaagtacttggaatcccgaagggcgttat
cagggccttctggatcctgagctctcacagaggggtttacagcaggcgcgtcttctggca
gaggctttgaggaatgtaccctttgatgtcatatactcctctcccctcagaagaacgtat
ctgaccgctttggagatagcaaagggaagagacgtgcatgtggtgaaggacgaaaggata
agggagatagatcacggcgtctggtccggtctcacagtagaggaggtcaaaaggaggttt
ccggaaactttcagaatgtggatggaggaaccccacagaaccagctttgaaggaggtgaa
agtctcaccgatgtctacagacgtgtggcggatttcgtggaggagataaagagaaagcac
cagcaccaaacggtggccgttgtttcccacactgtccccataagggccatgtactgttac
cttctgggtgtagatctttctcgtttttggagctttgggtgtgataacgccagctattcg
gttattcacttggaagaaaacagaaacgtgatccagaaactcaacataacttgtcactta
ggagagtattatgtggaggctcatagcgctctttag

DBGET integrated database retrieval system