KEGG   Thermocrinis albus: Thal_0879Help
Entry
Thal_0879         CDS       T01179                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22305  phosphoserine phosphatase [EC:3.1.3.3]
Organism
tal  Thermocrinis albus
Pathway
tal00260  Glycine, serine and threonine metabolism
tal00680  Methane metabolism
tal01100  Metabolic pathways
tal01120  Microbial metabolism in diverse environments
tal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Thal_0879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0879
Enzymes [BR:tal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     Thal_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADC89511
UniProt: D3SL81
Position
complement(830893..831528)
Genome map
AA seq 211 aa AA seqDB search
MVKLFVVRHAESTWNPEGRYQGLLDPELSQRGLQQARLLAEALRNVPFDVIYSSPLRRTY
LTALEIAKGRDVHVVKDERIREIDHGVWSGLTVEEVKRRFPETFRMWMEEPHRTSFEGGE
SLTDVYRRVADFVEEIKRKHQHQTVAVVSHTVPIRAMYCYLLGVDLSRFWSFGCDNASYS
VIHLEENRNVIQKLNITCHLGEYYVEAHSAL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctttgtggtgcgtcacgccgaaagtacttggaatcccgaagggcgttat
cagggccttctggatcctgagctctcacagaggggtttacagcaggcgcgtcttctggca
gaggctttgaggaatgtaccctttgatgtcatatactcctctcccctcagaagaacgtat
ctgaccgctttggagatagcaaagggaagagacgtgcatgtggtgaaggacgaaaggata
agggagatagatcacggcgtctggtccggtctcacagtagaggaggtcaaaaggaggttt
ccggaaactttcagaatgtggatggaggaaccccacagaaccagctttgaaggaggtgaa
agtctcaccgatgtctacagacgtgtggcggatttcgtggaggagataaagagaaagcac
cagcaccaaacggtggccgttgtttcccacactgtccccataagggccatgtactgttac
cttctgggtgtagatctttctcgtttttggagctttgggtgtgataacgccagctattcg
gttattcacttggaagaaaacagaaacgtgatccagaaactcaacataacttgtcactta
ggagagtattatgtggaggctcatagcgctctttag

DBGET integrated database retrieval system