KEGG   Thermocrinis albus: Thal_0879Help
Entry
Thal_0879         CDS       T01179                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22305  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
tal  Thermocrinis albus
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Thal_0879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0879
Enzymes [BR:tal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     Thal_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(830893..831528)
Genome map
AA seq 211 aa AA seqDB search
MVKLFVVRHAESTWNPEGRYQGLLDPELSQRGLQQARLLAEALRNVPFDVIYSSPLRRTY
LTALEIAKGRDVHVVKDERIREIDHGVWSGLTVEEVKRRFPETFRMWMEEPHRTSFEGGE
SLTDVYRRVADFVEEIKRKHQHQTVAVVSHTVPIRAMYCYLLGVDLSRFWSFGCDNASYS
VIHLEENRNVIQKLNITCHLGEYYVEAHSAL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctttgtggtgcgtcacgccgaaagtacttggaatcccgaagggcgttat
cagggccttctggatcctgagctctcacagaggggtttacagcaggcgcgtcttctggca
gaggctttgaggaatgtaccctttgatgtcatatactcctctcccctcagaagaacgtat
ctgaccgctttggagatagcaaagggaagagacgtgcatgtggtgaaggacgaaaggata
agggagatagatcacggcgtctggtccggtctcacagtagaggaggtcaaaaggaggttt
ccggaaactttcagaatgtggatggaggaaccccacagaaccagctttgaaggaggtgaa
agtctcaccgatgtctacagacgtgtggcggatttcgtggaggagataaagagaaagcac
cagcaccaaacggtggccgttgtttcccacactgtccccataagggccatgtactgttac
cttctgggtgtagatctttctcgtttttggagctttgggtgtgataacgccagctattcg
gttattcacttggaagaaaacagaaacgtgatccagaaactcaacataacttgtcactta
ggagagtattatgtggaggctcatagcgctctttag

DBGET integrated database retrieval system