KEGG   Thermocrinis albus: Thal_0879Help
Entry
Thal_0879         CDS       T01179                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_0879
   01230 Biosynthesis of amino acids
    Thal_0879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0879
  Energy metabolism
   00680 Methane metabolism
    Thal_0879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_0879
Enzymes [BR:tal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Thal_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830893..831528)
Genome map
AA seq 211 aa AA seqDB search
MVKLFVVRHAESTWNPEGRYQGLLDPELSQRGLQQARLLAEALRNVPFDVIYSSPLRRTY
LTALEIAKGRDVHVVKDERIREIDHGVWSGLTVEEVKRRFPETFRMWMEEPHRTSFEGGE
SLTDVYRRVADFVEEIKRKHQHQTVAVVSHTVPIRAMYCYLLGVDLSRFWSFGCDNASYS
VIHLEENRNVIQKLNITCHLGEYYVEAHSAL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctttgtggtgcgtcacgccgaaagtacttggaatcccgaagggcgttat
cagggccttctggatcctgagctctcacagaggggtttacagcaggcgcgtcttctggca
gaggctttgaggaatgtaccctttgatgtcatatactcctctcccctcagaagaacgtat
ctgaccgctttggagatagcaaagggaagagacgtgcatgtggtgaaggacgaaaggata
agggagatagatcacggcgtctggtccggtctcacagtagaggaggtcaaaaggaggttt
ccggaaactttcagaatgtggatggaggaaccccacagaaccagctttgaaggaggtgaa
agtctcaccgatgtctacagacgtgtggcggatttcgtggaggagataaagagaaagcac
cagcaccaaacggtggccgttgtttcccacactgtccccataagggccatgtactgttac
cttctgggtgtagatctttctcgtttttggagctttgggtgtgataacgccagctattcg
gttattcacttggaagaaaacagaaacgtgatccagaaactcaacataacttgtcactta
ggagagtattatgtggaggctcatagcgctctttag

DBGET integrated database retrieval system