KEGG   Thermocrinis albus: Thal_0944Help
Entry
Thal_0944         CDS       T01179                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tal  Thermocrinis albus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889375..890373)
Genome map
AA seq 332 aa AA seqDB search
MECKLYEKIRRGLALDKSEIKLLADIVREELKFLIRNHILPTPRNYERWFLVFCHALEGG
MRLSDQELMDLYSKIYGDRESFSEVAFDIEKTILVLETIVRDLQSALVESSEFTRKKEKE
LSKLQEDNVTPILLELLMHVKDLKKQNERFLKRIEEQNKVIEELKRRIQEVQTEANMDPL
TGLFNRRSLERAVEDLWKEFKKDGRVFSLILLDMDNFKSVNDVFGHAVGDLVLKRVAQAI
RSSLRARDIVGRWGGDEFMVLLPGTELEMARRIADRLSAVVGTLRIKVEGNELTVSLTPG
VAQVSEHHTSFMDLFKEADGQLYINKKKKGKE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggagtgtaaactctacgaaaagataaggagaggtcttgccctagataagagtgagata
aaactccttgctgacatcgtaagggaggagctcaagttcctgataagaaaccacatcctt
cccacgccccgcaattacgagaggtggtttttggtgttctgccacgctctggagggaggt
atgagactctccgatcaggagctcatggatttatacagcaagatatacggtgacagggaa
agtttcagcgaagtggccttcgatattgagaagacaatcttagttttggaaaccatagtg
agagatttacagtctgcccttgtagagagtagtgagttcaccaggaagaaggagaaagag
ttatcgaagttacaggaggacaacgtaacaccaatactgttggagttacttatgcatgtt
aaggatcttaaaaaacagaacgagcgcttccttaaacgcatagaggagcaaaacaaggtt
atagaagagcttaagagacgtatacaggaagttcagacagaggccaacatggatcccctc
acgggactctttaacagacgctcactggagagggccgtagaggatctttggaaggagttt
aaaaaagatggcagagtcttctcccttatacttctggatatggataactttaagagtgta
aacgacgtcttcggtcacgcggtgggagacttagtcttaaagcgcgtagcgcaggccatc
cgttccagccttagggcaagggacatagtaggaaggtggggaggggatgagtttatggta
cttcttcccggtaccgagctggaaatggcccgacggatagcagacagactaagtgctgtg
gtgggtacgttgaggataaaagtagaaggtaatgaacttaccgtaagcttaacaccggga
gttgcccaagtatctgagcaccacacttccttcatggacctcttcaaggaggcggatgga
caactctacataaacaagaagaaaaagggaaaagagtga

DBGET integrated database retrieval system