KEGG   Thermocrinis albus: Thal_1059Help
Entry
Thal_1059         CDS       T01179                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tal  Thermocrinis albus
Pathway
tal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
tal01130  Biosynthesis of antibiotics
tal01230  Biosynthesis of amino acids
Module
tal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thal_1059
Enzymes [BR:tal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thal_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth ThiG NanE
Motif
Other DBs
NCBI-ProteinID: ADC89691
UniProt: D3SLR1
Position
993283..994050
Genome map
AA seq 255 aa AA seqDB search
MSFLEKILKVKRREISKSKDYRKNLAQLISLRGPTRPWEQIFTKDGTRIIAEVKRASPSA
GSLKDVKASHQAVLYERAGAVAISVLTDKEFFKGSLEDLREVSAAVKVPVLRKDFLLDPV
QVEEARAFGADAVLLIVRILDDALLKDLLELSRELTLGHLVEVFNLREAERALKAGAYVI
GINNRDLDTFRVDISVTKQLAPVLKEMGARYVVAESGIESKDQIEELKKCGVDAFLIGTS
LMKSDDPVKKLMELL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgagctttcttgagaagatactaaaagtcaagaggagagagatttccaaaagtaaagac
tacagaaaaaaccttgctcagttaatatccctcagggggcccacacgtccttgggaacag
attttcacaaaagatggaacaaggataatagcggaagtcaagcgagcctcaccttctgcc
ggttctctgaaagatgtgaaggcctcccatcaggcggtactttacgaaagggccggggct
gtggctatatcggtactgacggacaaagagttcttcaaaggttctttggaggatcttagg
gaggtgagcgcggctgtgaaggtccccgttttacgtaaagactttctgttagatcccgtg
caggtagaggaagcgagagccttcggagcggacgctgttctcctaatagtgaggatctta
gacgatgcgctcctgaaggatcttttggaactgtcccgtgaactaacacttgggcatctg
gtggaagtctttaaccttagggaggcggagagagctctcaaagcaggtgcttacgttata
ggcatcaacaacagggaccttgataccttcagggtggatatatctgtgacaaaacagctg
gcacctgtcctgaaagagatgggtgccaggtatgtggtggcagagagcggtatagaaagc
aaagaccagatagaggaacttaaaaagtgtggtgtagatgcctttctgataggtacaagt
cttatgaagagtgacgatcctgttaaaaaacttatggagctgttataa

DBGET integrated database retrieval system