KEGG   Thermocrinis albus: Thal_1241Help
Entry
Thal_1241         CDS       T01179                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tal  Thermocrinis albus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thal_1241
Enzymes [BR:tal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Thal_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159571..1160128
Genome map
AA seq 185 aa AA seqDB search
MKMLKWAVRKILKAAHLLYQEGLVDARAGNISFRIDDKIIITRTGSHLGELTEEDLILLP
LLGTTPLLERASSEMPVHREVYLRTSHRAVVHAHPPATVSLSLREEKIIPVDSEGKILLK
EVCVVEDLPSGSEALAEAVANLLQDNSLVVVRGHGVFAADRDPMKAYGWISVLERSCRIL
QETLP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcttaaatgggcggtaagaaagatactgaaagcggctcatctcctctaccaa
gaaggattggtggatgctcgcgccggcaacatctcctttaggatagacgataaaatcatc
attacccgcaccggcagtcaccttggagagcttacagaggaagatcttatcctgctacct
ctgttgggtactaccccacttttggagagggcttcttccgagatgccggtccacagagag
gtataccttcgtacatctcacagggccgtggtgcacgctcacccacctgctaccgtttct
ctgtctttaagagaagaaaagataataccggtagactcggagggtaagatacttctgaag
gaggtgtgtgtggtggaggaccttccttcgggaagtgaggctctcgcggaggcggtggct
aaccttctgcaggacaactctctggtggtggtaagggggcacggtgtttttgcagcggac
agagatcccatgaaagcctatggctggatatcggtcttagaaagatcctgcaggatactt
caggagactcttccgtag

DBGET integrated database retrieval system