KEGG   Thermocrinis albus: Thal_1281Help
Entry
Thal_1281         CDS       T01179                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tal  Thermocrinis albus
Pathway
tal00860  Porphyrin and chlorophyll metabolism
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thal_1281
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Thal_1281
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Thal_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 HI0933_like Pyr_redox_3 Lycopene_cycl Pyr_redox_2 FAD_binding_3 FAD_oxidored Pyr_redox NAD_binding_9 GDI GIDA Latexin TrkA_N K_oxygenase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADC89912
UniProt: D3SMD2
Position
complement(1196910..1198211)
Genome map
AA seq 433 aa AA seqDB search
MMDVIVVGAGISGLSVAFRLSKEGLKVKVLEKEEEPGGNIRTRKVGDFLCELGPQTVLAD
GEVVDFFREVGIQPQEASPSSSVRYIYKRGKLIPLPNSPVKFLTSPLLSLGGKLRVLMEP
FVAPSVKTEETVAQFVRRRLGEEFLHYVITPFVRGVYAGDPEELSIKYAFRRVYQLEREY
GSLIRAAIKLKRLGPPGKIISFEGGNQSIIQQLASYVDLETENVALRIRRKDDRYILDTK
EGKYEARCVVVASPATSAGYLLRDISWSAAQELDKIYYAPVVVVHVATSQNIPDGFGFLA
PQKEDLRILGVLFSSRIFPNKAPQGKELLTIYMGGATDPEVVEYEDELIMRIVEEDLRKS
LGLTQLEFLLVTRWKRAIPQYTLGYGRYIELVEALQRENPGLFITGNYLEGVSVADCIKR
SKRVVQEVVKFFR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttatagtggtaggagccggtatatcgggtctctcggtggccttcagactg
tcaaaggaaggcctcaaggtgaaggttctggaaaaggaagaagagcccggaggaaacata
cgcacgcggaaagtgggtgactttctctgtgaacttggtccccaaacggtgttggccgat
ggggaggtggtagatttcttccgtgaggtgggtatacaaccccaggaagcctcgccttcc
tcctccgttagatatatctataagagaggaaaacttatcccactccccaatagtcccgta
aagtttctcacctctcccctgctatccttaggtggtaaactgagggtgttgatggagccc
ttcgtggcaccttctgtaaaaacagaagaaacggtggctcagtttgtaagaagaagactg
ggagaagagtttcttcactacgtgataactcccttcgtgaggggtgtgtacgccggtgac
ccggaggagctctccataaagtacgccttcagaagggtataccagttggagagagagtac
ggaagcctgataagggctgccatcaagttaaagaggctcggacctccgggaaaaataatc
tcctttgaaggaggaaaccagagcatcatccaacaactggccagttatgtggatctagag
acggagaacgtggcactccgtataaggaggaaggacgatagatacatactggacaccaaa
gagggaaagtacgaagcacggtgtgtggtagtggcatctcctgccacatctgcaggttat
cttctgagggatatctcttggagtgctgcgcaggaactggacaaaatatactacgcccca
gtagtggtggtacatgtggccacatctcagaatatacctgacggcttcggttttctggca
ccccagaaggaagatctgaggatactgggagttctcttctcctcacgtatctttcctaac
aaggctccgcaagggaaagaactcctcaccatctacatgggaggtgccaccgatccggaa
gtggtagagtacgaagatgagctcataatgcgtatagtggaagaagatctaagaaagagc
ttgggtctaacccaactggagttcctcctcgttacacggtggaagagagccatacctcag
tacacactgggatacggtagatacatagaactggtggaagcactgcagagggaaaaccct
ggactttttataacaggcaactacctggaaggtgtgtctgtggcggattgcataaagaga
tccaaaagggtggtacaggaggtggtaaagttcttccgatga

DBGET integrated database retrieval system