KEGG   Thermocrinis albus: Thal_1281Help
Entry
Thal_1281         CDS       T01179                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tal  Thermocrinis albus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thal_1281
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Thal_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196910..1198211)
Genome map
AA seq 433 aa AA seqDB search
MMDVIVVGAGISGLSVAFRLSKEGLKVKVLEKEEEPGGNIRTRKVGDFLCELGPQTVLAD
GEVVDFFREVGIQPQEASPSSSVRYIYKRGKLIPLPNSPVKFLTSPLLSLGGKLRVLMEP
FVAPSVKTEETVAQFVRRRLGEEFLHYVITPFVRGVYAGDPEELSIKYAFRRVYQLEREY
GSLIRAAIKLKRLGPPGKIISFEGGNQSIIQQLASYVDLETENVALRIRRKDDRYILDTK
EGKYEARCVVVASPATSAGYLLRDISWSAAQELDKIYYAPVVVVHVATSQNIPDGFGFLA
PQKEDLRILGVLFSSRIFPNKAPQGKELLTIYMGGATDPEVVEYEDELIMRIVEEDLRKS
LGLTQLEFLLVTRWKRAIPQYTLGYGRYIELVEALQRENPGLFITGNYLEGVSVADCIKR
SKRVVQEVVKFFR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttatagtggtaggagccggtatatcgggtctctcggtggccttcagactg
tcaaaggaaggcctcaaggtgaaggttctggaaaaggaagaagagcccggaggaaacata
cgcacgcggaaagtgggtgactttctctgtgaacttggtccccaaacggtgttggccgat
ggggaggtggtagatttcttccgtgaggtgggtatacaaccccaggaagcctcgccttcc
tcctccgttagatatatctataagagaggaaaacttatcccactccccaatagtcccgta
aagtttctcacctctcccctgctatccttaggtggtaaactgagggtgttgatggagccc
ttcgtggcaccttctgtaaaaacagaagaaacggtggctcagtttgtaagaagaagactg
ggagaagagtttcttcactacgtgataactcccttcgtgaggggtgtgtacgccggtgac
ccggaggagctctccataaagtacgccttcagaagggtataccagttggagagagagtac
ggaagcctgataagggctgccatcaagttaaagaggctcggacctccgggaaaaataatc
tcctttgaaggaggaaaccagagcatcatccaacaactggccagttatgtggatctagag
acggagaacgtggcactccgtataaggaggaaggacgatagatacatactggacaccaaa
gagggaaagtacgaagcacggtgtgtggtagtggcatctcctgccacatctgcaggttat
cttctgagggatatctcttggagtgctgcgcaggaactggacaaaatatactacgcccca
gtagtggtggtacatgtggccacatctcagaatatacctgacggcttcggttttctggca
ccccagaaggaagatctgaggatactgggagttctcttctcctcacgtatctttcctaac
aaggctccgcaagggaaagaactcctcaccatctacatgggaggtgccaccgatccggaa
gtggtagagtacgaagatgagctcataatgcgtatagtggaagaagatctaagaaagagc
ttgggtctaacccaactggagttcctcctcgttacacggtggaagagagccatacctcag
tacacactgggatacggtagatacatagaactggtggaagcactgcagagggaaaaccct
ggactttttataacaggcaactacctggaaggtgtgtctgtggcggattgcataaagaga
tccaaaagggtggtacaggaggtggtaaagttcttccgatga

DBGET integrated database retrieval system