KEGG   Thermocrinis albus: Thal_1317Help
Entry
Thal_1317         CDS       T01179                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tal  Thermocrinis albus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thal_1317
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Thal_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1234383..1235135)
Genome map
AA seq 250 aa AA seqDB search
MKKRAALCGSRKKEEFLKMMAETDIEAYVEEVVTIEYLPAEEVAKKLEEVLSLKPSHFLF
TTGEGVQRLFQVAEEYGVLPHLLQLLKNCVILCRGYKTRGVLLKYGLSIAAYSESTSHLL
NTLKDDVKIAVQPYGEEIEELKGRAFVLPVYRYKMDTNRMDAFIEKLLKGFYHGVLFTSP
YQVRYTFARARDIGMEGYLANVMTDRVLVVAVGHMTAEELYKAGVFRVLKPPKERFPLAV
RELLKGLDRG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacgagctgcactgtgcggaagcaggaagaaggaggagttccttaagatgatg
gcggaaactgacatagaggcttatgtagaagaggtggttacaatagagtatctgccagca
gaggaagtagccaaaaaactggaggaggttttgtccttaaaaccaagccatttccttttc
acaacgggtgagggagtccagagactatttcaggtagctgaagaatacggagttctacct
caccttctccaactcctgaagaactgtgtcatactctgcagaggttacaaaactaggggt
gtactcctcaagtacggcttatccatagctgcctactctgaaagtaccagccatcttctt
aacacccttaaggacgatgtaaagatcgctgtccaaccctacggtgaagagatagaggaa
ctgaagggtagggcctttgtacttcccgtttacaggtataagatggataccaacaggatg
gacgcttttatcgaaaagttactgaagggtttctaccacggcgtactctttacatctcct
taccaagtgaggtacacctttgctagggccagggatatcggcatggaaggatatcttgcg
aatgttatgacagacagggttttggtggtggcggtggggcacatgacagcggaggagctg
tataaagcgggagtgttcagagtgttaaaaccacctaaggagagattcccgttggctgtg
agagagttactgaagggtcttgaccgtgggtaa

DBGET integrated database retrieval system