KEGG   Thermocrinis albus: Thal_1362Help
Entry
Thal_1362         CDS       T01179                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tal  Thermocrinis albus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tal00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268615..1269898
Genome map
AA seq 427 aa AA seqDB search
MRDITSYVSDIFLIEGGKTLRGTVHVSGSKNASLPILMATLLTEEKCVIKRVPDLLDVRT
TLELLTQLGADAEYENGTVTACASRSLQHITPDHLVRRMRASILVMGPLLARCGRAVVGM
PGGCSIGVRAIDQHLKLFEKAGARVSIRHGYIHMEIDKINPVEYTFEVITVTGTENALML
LSKCERRSVLRNIALEPEVMDLVEVLRKMGASIEIDGRTAIIQGSDSLSGFEHTVIPDRI
EAGTFMVGAVMTFGDVLLKDVRVDHLGAIMEKLKEAGATVEVINPTEVRVSMRKDRIAPL
EISTAEYPGFPTDMQAQFMAMCSIADGTSYITENIFENRFQHVAELQRMGASIKVRGRTA
TVVGVDKLSGAEVYSTDLRASACLVLAGLVAEGTTVVRDIYHLDRGYEKLEEKLKSLGAS
VVRVPQR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagagacatcacatcatacgtttctgacattttcctcatagaaggtgggaagacactg
aggggaactgtgcatgtatcaggttctaaaaacgcttctctacccatacttatggctaca
ctcctcacagaagaaaagtgtgtaataaagcgtgtaccggatctccttgatgtgagaacc
acactggagcttctcacacaacttggagcggatgcagagtatgagaatggtaccgtgaca
gcttgtgcgagcagatcccttcagcatatcacccctgaccatcttgtcagaaggatgagg
gcttccatattggtgatggggccacttttggcaaggtgtggaagagctgtggtgggaatg
cccggaggttgttctataggtgtgagggctatagatcagcacctgaaactctttgaaaag
gctggggcacgcgtaagcatacgtcacggttatatacacatggagatagacaaaataaac
cctgtggaatacacctttgaggtcataacggtgacgggaacagaaaacgctctgatgctc
ctcagtaagtgtgagaggaggagtgtactgaggaacatagcccttgaacccgaagttatg
gatcttgtggaggtcctacgtaagatgggtgccagcatagagatagatgggagaacggct
ataattcaaggtagtgattcactatccggttttgagcataccgttatccccgacagaata
gaagcgggtacctttatggtgggagctgttatgactttcggtgatgtgcttttaaaggac
gtgagggtagatcatctgggagctataatggaaaaacttaaggaagcgggagccaccgta
gaggttataaaccccaccgaggtacgcgtttccatgaggaaagatcgtatagcacctctg
gagatatccactgcagagtatccgggttttcccaccgacatgcaggcgcagtttatggcc
atgtgttccatagccgacggaacgtcttacataacagagaacattttcgaaaacaggttc
caacacgtagctgaacttcagaggatgggagcctccataaaggtaagaggtaggacagct
accgtggtgggcgtggataaactgagtggagccgaggtttactccacagacctcagagct
tctgcttgtcttgtgttagcagggctcgtggctgagggcactactgtggtgagagatatc
taccatctggacagggggtatgaaaagttggaagaaaaactaaaaagtctgggggcctct
gtggttagagtcccccagaggtaa

DBGET integrated database retrieval system