KEGG   Thermocrinis albus: Thal_1364Help
Entry
Thal_1364         CDS       T01179                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tal  Thermocrinis albus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tal00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270388..1270963)
Genome map
AA seq 191 aa AA seqDB search
MKVKLCPHDALIVVDVQNDFMPWGALPVPEGDKVVEPLNQYIDIFHRKGLPVFFTRDWHP
PDHISFKGHGGIWPPHCVQDTEGAMFHKDLFIPPDNKFIISKGTSRDFDAYSGFQGTFLD
QLLRERGVKRIFVGGVATDYCVKNTVLGGLHLGYQVFLLHDAVRGLEGSTRAIEEMQEAG
TVLVERGDLTI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaagctctgtcctcatgacgcccttatagtggtagatgtacaaaatgatttt
atgccgtggggagctctacctgtaccagaaggtgacaaagtggttgaacctcttaaccag
tacatagatatctttcacaggaagggtctgccggtgttcttcacaagagactggcaccca
ccggatcatatatctttcaaaggtcacggcggtatatggccacctcactgcgtacaggac
acagaaggtgctatgtttcacaaggatcttttcatccctcccgacaacaaattcatcatt
tctaaaggaaccagtagagacttcgatgcttactccggctttcagggaaccttcctggac
cagcttctgagggaaaggggagtaaagcgcatctttgtgggaggagtggccaccgattac
tgtgtgaaaaacacggtgctgggtggtctccatcttggataccaggtcttcttactgcat
gatgctgtaagaggcttagaaggatctacaagagccatagaggagatgcaggaggccggt
accgtactggtggaaagaggggacttgacaatttga

DBGET integrated database retrieval system