KEGG   Thermocrinis albus: Thal_1461Help
Entry
Thal_1461         CDS       T01179                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tal  Thermocrinis albus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Class
Metabolism; Overview; Carbon metabolism [PATH:tal01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tal00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tal00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:tal00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:tal00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364035..1365183
Genome map
AA seq 382 aa AA seqDB search
MKLHEHQAKEIFGRYGLPVPKGGVAFSVEEAQRVAEELGSFPLVVKAQVHCGGRGKAGGV
KLVHSMEELTQAVESMLGKVLKTFQCPEGKPVSRVWIEKATPIKKEYYFSITLDRSAAKP
VIMASAEGGMEIEEVAKEKPDAILMLHVDPALGLMPSQARKIAFRLGLPVDRFVPLALNL
YKLYMDLDASLVEVNPLVLTEEGDLVILDAKVDVDDNALMRHRDIQEMEDLTQLDPLEVE
AKKYGLNYIKLDGNIGCMVNGAGLAMTTMDIIKLAGGNPANFLDVGGGASVEQIANAFRI
LMADPNVKAVFINIFGGILRCDRLASGLIEAAKMVDISVPVVVRMEGTNVEEGKRMLAES
GLRFVTAEDMWDGARKAVELAS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaacaccaggctaaagagattttcggtagatatggccttcccgttccc
aaaggtggtgttgcttttagcgtagaagaagcccaaagagtagctgaagagctgggttcc
ttccccctagtggtaaaggctcaggtccactgcggtggtagaggtaaggctggtggtgta
aagctggtgcacagtatggaggagctaacgcaggctgttgagagtatgctaggaaaggtt
ctcaaaaccttccaatgtccggagggtaaacctgtaagcagagtgtggatagaaaaggcc
acccccataaagaaagagtactacttttccataactcttgacagatcagcggccaaacct
gtaataatggcctctgcagaaggtggtatggagatagaggaggtggcaaaggagaaacct
gacgctatcctgatgctacacgtagatccagccttaggtctcatgccatctcaggcaagg
aagatagccttccggctaggtcttccagtagacaggtttgttcccttggccctcaacctt
tacaagctttacatggatttagatgcctctcttgtagaggtaaacccccttgttctgaca
gaggaaggagacctcgtgattttggatgctaaggtagatgtggatgacaacgctctcatg
aggcacagggacatacaagagatggaggacctaacccagctggatcctttagaggtggag
gctaagaagtacggtcttaactacataaagctggatggtaacataggatgtatggtgaac
ggtgcagggctggctatgaccaccatggacatcataaaactggcaggtggaaatccggcc
aacttcttagacgtagggggtggtgccagtgtggaacagatagcgaacgccttccgcatc
cttatggcagatcccaacgtaaaggctgtgttcatcaacatctttggtggtatactgagg
tgcgataggttagccagtggtctcatagaggctgctaagatggtggacattagtgtaccg
gtagtggtgagaatggagggcaccaacgtggaggaaggcaagagaatgttggcggaatcc
ggtctgaggtttgtgacggcagaagacatgtgggatggtgccagaaaggctgtggaacta
gcttcctaa

DBGET integrated database retrieval system