KEGG   Thermocrinis albus: Thal_1461Help
Entry
Thal_1461         CDS       T01179                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tal  Thermocrinis albus
Pathway
tal00020  Citrate cycle (TCA cycle)
tal00640  Propanoate metabolism
tal00660  C5-Branched dibasic acid metabolism
tal00720  Carbon fixation pathways in prokaryotes
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
tal01120  Microbial metabolism in diverse environments
tal01130  Biosynthesis of antibiotics
tal01200  Carbon metabolism
Module
tal_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thal_1461
   00640 Propanoate metabolism
    Thal_1461
   00660 C5-Branched dibasic acid metabolism
    Thal_1461
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_1461
Enzymes [BR:tal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Thal_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Succ_CoA_lig ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADC90090
UniProt: D3SMW0
Position
1364035..1365183
Genome map
AA seq 382 aa AA seqDB search
MKLHEHQAKEIFGRYGLPVPKGGVAFSVEEAQRVAEELGSFPLVVKAQVHCGGRGKAGGV
KLVHSMEELTQAVESMLGKVLKTFQCPEGKPVSRVWIEKATPIKKEYYFSITLDRSAAKP
VIMASAEGGMEIEEVAKEKPDAILMLHVDPALGLMPSQARKIAFRLGLPVDRFVPLALNL
YKLYMDLDASLVEVNPLVLTEEGDLVILDAKVDVDDNALMRHRDIQEMEDLTQLDPLEVE
AKKYGLNYIKLDGNIGCMVNGAGLAMTTMDIIKLAGGNPANFLDVGGGASVEQIANAFRI
LMADPNVKAVFINIFGGILRCDRLASGLIEAAKMVDISVPVVVRMEGTNVEEGKRMLAES
GLRFVTAEDMWDGARKAVELAS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaacaccaggctaaagagattttcggtagatatggccttcccgttccc
aaaggtggtgttgcttttagcgtagaagaagcccaaagagtagctgaagagctgggttcc
ttccccctagtggtaaaggctcaggtccactgcggtggtagaggtaaggctggtggtgta
aagctggtgcacagtatggaggagctaacgcaggctgttgagagtatgctaggaaaggtt
ctcaaaaccttccaatgtccggagggtaaacctgtaagcagagtgtggatagaaaaggcc
acccccataaagaaagagtactacttttccataactcttgacagatcagcggccaaacct
gtaataatggcctctgcagaaggtggtatggagatagaggaggtggcaaaggagaaacct
gacgctatcctgatgctacacgtagatccagccttaggtctcatgccatctcaggcaagg
aagatagccttccggctaggtcttccagtagacaggtttgttcccttggccctcaacctt
tacaagctttacatggatttagatgcctctcttgtagaggtaaacccccttgttctgaca
gaggaaggagacctcgtgattttggatgctaaggtagatgtggatgacaacgctctcatg
aggcacagggacatacaagagatggaggacctaacccagctggatcctttagaggtggag
gctaagaagtacggtcttaactacataaagctggatggtaacataggatgtatggtgaac
ggtgcagggctggctatgaccaccatggacatcataaaactggcaggtggaaatccggcc
aacttcttagacgtagggggtggtgccagtgtggaacagatagcgaacgccttccgcatc
cttatggcagatcccaacgtaaaggctgtgttcatcaacatctttggtggtatactgagg
tgcgataggttagccagtggtctcatagaggctgctaagatggtggacattagtgtaccg
gtagtggtgagaatggagggcaccaacgtggaggaaggcaagagaatgttggcggaatcc
ggtctgaggtttgtgacggcagaagacatgtgggatggtgccagaaaggctgtggaacta
gcttcctaa

DBGET integrated database retrieval system