KEGG   Thermocrinis albus: Thal_1463Help
Entry
Thal_1463         CDS       T01179                                 

Definition
dTDP-glucose 4,6-dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
tal  Thermocrinis albus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Thal_1463
   01055 Biosynthesis of vancomycin group antibiotics
    Thal_1463
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thal_1463
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Thal_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366029..1366985)
Genome map
AA seq 318 aa AA seqDB search
MKLLITGGAGFIGSEFTRQAVKEGYQCVVVDKLTYAGDIRRLEEVLEKITFYRCDINNRE
FLEYIFSKEKPDVVVHWAAESHVDRSISDPSPFFTTNVLGTLNLLDTAKKYGVKSFINIS
TDEVYGELGDEGSFKEDSCLKPNSPYSVSKASADMLGRAYFRTYGLPVITVRPSNNYGPW
QYPEKLIPVVIVKAIKNEPIPIYGRGLNVREWLYVSDCAEAVLEIIKKGEPGEIYNVGSG
EERRNIEVAKLILSILGKPEDLISFVQDRPGHDYRYSLDVSGTWEKLGWKAKTKLEEGIR
RTVEWYLDHIDWALEKVT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgataacaggaggtgcgggtttcataggcagcgaatttacccgtcaagcg
gtgaaagaaggttaccagtgcgtagtggtagataagctcacttacgcaggcgatataagg
agactggaggaggttttggagaagattaccttctacaggtgtgatatcaacaacagggag
tttttggagtacatattcagtaaagaaaagccggacgtggtggttcactgggcagcagaa
agccatgtagacagaagtatctcggatccctctccctttttcaccaccaacgttttgggt
acgctgaaccttctggatacagcaaagaaatacggcgttaaaagttttatcaacatatcc
accgacgaagtttacggtgagctgggtgatgaaggttcttttaaggaagattcatgcctc
aaacccaactcgccttactctgtttctaaagccagtgccgatatgctaggtagggcttac
tttagaacctacgggcttcctgttataacagtgagaccttccaacaactacggaccgtgg
cagtatccggaaaagctcatacctgtggtgatagtgaaagccatcaagaacgagcctata
cccatctatgggcgtggactcaacgtgagggaatggctttacgtaagtgactgtgcggag
gctgtccttgagatcatcaagaagggtgaacctggagaaatctacaacgtaggtagtgga
gaggaaagaagaaacatagaagtggccaagttgatactcagtatccttggaaaacctgag
gatcttatcagctttgtgcaggacagaccggggcatgattacagatactccctcgatgtt
tccggaacatgggagaagctcggctggaaggctaaaaccaagttggaagaaggcataaga
cgtacggtagagtggtacttagatcacatagactgggctctggaaaaggtaacatga

DBGET integrated database retrieval system