KEGG   Thermocrinis albus: Thal_1468Help
Entry
Thal_1468         CDS       T01179                                 

Definition
aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain-containing protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tal  Thermocrinis albus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thal_1468
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thal_1468
Enzymes [BR:tal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Thal_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369399..1370283
Genome map
AA seq 294 aa AA seqDB search
MRSLISVLDLNREDVLNLYQLFLDFKRGRREKLDGSVMLLFLESSTRTRLSFEKACRQLG
LETYYAGKGETSIDKGETLLDTFRTLKYLGFDAVVFRIPFVLFPYQEYIREGIVLVNAGD
GTHQHPTQGLVDLFTAMEVFGSLEGVKVLFVGDILHSRVFRSTAPLFRMMGAQIGICGPA
TLLPYDPSSLGVSMVFHQVEEGLRWADLVEYLRLQKERFKENYISSERSYFAQFGMTKER
YEGFKGYVMHPGPVNLYVDMDPEVVYGERSLVAEQVRNGVFVRMAVMYYLMKDG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtcttatatcggtcctggacctcaacagagaggatgtactgaatctctaccag
ctttttctggactttaagaggggtagaagggaaaaactggatgggtcagtcatgctgctt
ttcttggaaagttccacccgtacacgcctctcctttgaaaaggcatgccgacagttgggc
ttggaaacttactatgccggcaaaggagaaacctctatagataagggagaaactctatta
gacactttccgaacgctgaaatatctgggatttgacgcggtggtgtttcggatccccttc
gtcctattcccataccaggagtacataagggaaggtatcgtgcttgttaacgcgggagat
ggtacacatcaacatccaacacagggactagtggatctcttcaccgctatggaggttttt
ggatctttggaaggtgttaaggtgctctttgtgggagacattctccacagcagagtgttt
aggtccacggctcccctgtttcgtatgatgggagctcagataggaatatgtggtcctgct
actctccttccctatgatccttcatccttaggtgtgagcatggtatttcaccaagtggaa
gaaggtttaaggtgggcggatcttgtggaataccttcgacttcagaaggaacgttttaag
gagaactatatatcttccgagagaagttactttgcccagtttggtatgacaaaggagagg
tacgagggattcaaaggttacgtgatgcatccgggacctgttaacttgtacgtggacatg
gatcctgaggtggtgtacggggaaagatccttagtggctgagcaggtaaggaacggcgtg
tttgtacgtatggcggtgatgtactatcttatgaaagatggctaa

DBGET integrated database retrieval system