KEGG   Thermocrinis albus: Thal_1494Help
Entry
Thal_1494         CDS       T01179                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tal  Thermocrinis albus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tal03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1396445..1397053)
Genome map
AA seq 202 aa AA seqDB search
MAYQEYIPPVLKRALEVLTYIPTYGERSASRFVYNFLKLSPEERDEILKTLFELSRSARK
CSECGLVSDTDPCRICSDTKRNKRFLCVVEESQDAYAIERLERYTGVYHVLGGRIAPLEG
ISAEDLNIEGLLRRIENYGVKEVILATNPNVEGEATANYILSLIKKRFPSVKVSRISHGL
QFGSLIELADDLSLERSIENRR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaggaatacataccgccggttttaaaaagggcgttggaggtgctaacttat
atacccacctacggcgagaggagtgcctctcgttttgtgtacaactttctaaaactgagc
ccagaggagcgtgatgagatcctaaagactctttttgaactctctcgatctgccagaaaa
tgcagcgagtgtggtcttgtatccgatacggatccgtgtaggatatgtagcgatactaag
agaaataagcgctttttgtgtgtggtagaggaatctcaggacgcttacgctatagagcgt
ctggagagatacacaggtgtgtatcacgttttgggagggaggatagcacccttggagggt
atctccgcagaggacctcaacatagaaggccttcttaggagaatagaaaactacggtgtg
aaggaggttatactggccacaaaccccaacgtggagggagaagcaacggccaactatatt
ctttccctcataaaaaaacgctttccttctgtcaaagttagccgtatatctcacggtctg
cagtttggatccctcatagagttggcagacgatctgtccttggaaagatccatagagaac
agacgctga

DBGET integrated database retrieval system