KEGG   Thermocrinis albus: Thal_1523Help
Entry
Thal_1523         CDS       T01179                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tal  Thermocrinis albus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thal_1523
   01230 Biosynthesis of amino acids
    Thal_1523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_1523
   00030 Pentose phosphate pathway
    Thal_1523
   00051 Fructose and mannose metabolism
    Thal_1523
  Energy metabolism
   00680 Methane metabolism
    Thal_1523
Enzymes [BR:tal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thal_1523
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thal_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1424387..1425532)
Genome map
AA seq 381 aa AA seqDB search
MKITLSVIKADIGGYVGHSHAHPDVVEAVKEVGKEAVKKGTLIDCDVLVCGDDIALVMTH
THGVDSPVVHGLAWEAFQRGTQVAKKLKLYGAGQDLLSDAFSGNVKGMGPGVAEMEFEER
PSEPVIVFFADKTAPSAWNLALYEMFADPMVCSGLVIDPKMHEGFTFEVLDTFTGKAVKL
STPSELYDLLALIGTVERYAVRSVWRNSDGEIAAVASTQRLSLIAGRYVGKDDPVLIVRA
QSGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFRHATPSRFDGPPRVIAAGYQLSE
GKLIGPRDLFDDPAFDNARQTAQMMADILRRQGIFEPHRLPSEEMEYTTLPKILKKLEGR
FYNLEEGKKEPVEHQQHADVD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagataactctcagcgtcatcaaagcagatataggtggatacgtaggacactctcat
gctcatcccgacgtagtggaggcggtgaaagaggtaggtaaagaagctgtcaaaaaggga
acgcttatagattgtgatgtactggtatgtggtgatgacatagctctggtcatgacccac
acccacggcgttgatagtcccgtggtacacggtctcgcatgggaggccttccaaagaggg
acacaggtggctaaaaaactgaagctctacggtgcaggacaggatcttttgtcggatgcc
ttttcgggtaacgtaaaggggatgggtccgggtgtggcggagatggagtttgaggaaaga
ccttcggaacctgttatagtcttctttgccgacaaaacggcacccagtgcctggaacttg
gccctttacgagatgtttgcagaccctatggtttgctccggtttagtgattgatcccaag
atgcacgaaggtttcacctttgaggtgttggacacctttaccggtaaggctgtaaagctg
tccacaccctccgagttgtacgatcttcttgccctcataggaacggtggagcgatatgcg
gtaagaagtgtgtggaggaactcggacggagagatagcagcggtggcgtctacacagcgt
ctctctttaatagctggtagatacgtggggaaggacgatcctgtattaatagtgagagct
cagtcaggattccctgcggtaggtgagatcttagagccctttgcaagaccttggatagtg
gaaggttggatgagaggatcccacaacggtcctctgatgcccgtgtccttcaggcatgca
acacccagcaggtttgacggtcctccgagggtgatagcagcaggttaccaactgtcggag
ggtaagctgataggtcccagagatctctttgatgatcctgccttcgataacgccaggcag
acggcccagatgatggccgacattctcaggcgtcagggaatatttgagcctcaccgccta
ccttctgaggagatggagtataccacactacccaagatactgaagaaactggaaggtaga
ttttataacctagaggagggtaagaaggaacctgtggaacaccaacaacacgccgatgtg
gattga

DBGET integrated database retrieval system