KEGG   Thermocrinis albus: Thal_1532Help
Entry
Thal_1532         CDS       T01179                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tal  Thermocrinis albus
Pathway
tal00260  Glycine, serine and threonine metabolism
tal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
tal01130  Biosynthesis of antibiotics
tal01230  Biosynthesis of amino acids
Module
tal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thal_1532
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thal_1532
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thal_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA His_biosynth DUF561
Motif
Other DBs
NCBI-ProteinID: ADC90161
UniProt: D3SN31
Position
complement(1429659..1430450)
Genome map
AA seq 263 aa AA seqDB search
MGRERLKQTFSRLKDKGEAALVSYLMVGYPELDFSLQAFLTVVQNGTDILEVGVPFSDPV
ADGPTIQKAHEGALRNGVRLKDVFHQVSKIRENYPEIPILLMTYYNPVFRTGLEKFCRMA
ADSGADGLIVPDLPPEESGPLKEHTLRADLSLVLLASPTSTTRRLKLICDTTDDMVYFVS
VTGTTGARESLPLERLSQQLKTYRQVCSKPVVVGFGVSKREHASALKDIADGVVVGSALV
SLAEDKDLKALASKVREIKEALS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagaaaggctgaagcagactttttcccgcctgaaggataagggtgaagctgct
ttagtgtcttacctgatggtgggttatccggagctggacttttctctacaagcttttctc
accgtggtgcaaaacggtaccgacatactggaggtaggtgttcccttctctgatcctgtg
gcagatggtcccaccatccagaaggctcacgagggagctttgcgtaacggtgtcagactt
aaagatgtctttcatcaggtaagtaagataagggaaaactatccggaaatccccatcctt
cttatgacttactacaaccccgtttttcgtacgggcctggagaagttctgccgtatggca
gcagacagcggtgcagacggtctgatagttcccgatctgccacccgaggaaagcggtcct
cttaaggagcacactttacgcgctgatctttcactggtgcttctggcatctcccaccagc
accactaggagactgaagctcatatgtgataccacagacgatatggtttacttcgtttcc
gtaacaggtaccaccggagccagagaatcccttcccttagaaagactctctcaacagctt
aaaacctacaggcaggtgtgctcaaaaccggtggtggtaggtttcggagtttccaaaagg
gaacacgccagtgccctgaaagacatagcggacggtgtggtggtagggagtgccctcgtg
tctttagcggaggataaagatctcaaagcgttagccagcaaggtaagagagataaaggaa
gctctaagctga

DBGET integrated database retrieval system